PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen07g030940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 301aa    MW: 33519.1 Da    PI: 5.9195
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen07g030940.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.91.6e-11181226550
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                       kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Sopen07g030940.1 181 KRIKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVA 226
                       899**********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-14177241IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.68179231IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.1E-14181232No hitNo description
PfamPF001703.9E-10181226IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-11181235No hitNo description
CDDcd147033.62E-24182232No hitNo description
PROSITE patternPS000360184199IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MAQLPPKVPT MAHNWPFQNM PPLPNSSTIV SNHHTTNSWV DDFLDFSSSR RNSHRRSVSD  60
PIAFVEAPFL QQCRGNGLSN GFDKLDDEQL TTMFSDDSGA GAAFAGTAPC SNPSSTNPST  120
PSDQVSENED QRSPVRLEVN LVVQPKNEPG EDDSDNQSPV TSKNPVNDSS DNNNNSIVDP  180
KRIKRILANR QSAQRSRVRK LQYISELERS VTTLQTEVSA LSPRVAFLDH QRLLLNVDNS  240
ALRQRIAALA QDKIFKDAHQ EALKKEIERL RQIYHEQNMK KMNTADEPPS TAAPMSCTEE  300
A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015080476.10.0PREDICTED: basic leucine zipper 34-like
SwissprotQ9M2K45e-91BZP61_ARATH; Basic leucine zipper 61
TrEMBLM1AXB90.0M1AXB9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000323810.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17752465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.19e-64bZIP family protein