PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen07g027590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 340aa    MW: 37686.8 Da    PI: 6.191
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen07g027590.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1322.7e-10140195560
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                       kr++r   NR +A rs +RK  +i eLe+kv++L+ae ++L  +l   +     l+
  Sopen07g027590.1 140 KRAKRILANRQSAARSKERKTRYISELERKVQTLQAEATTLSTQLTLFQRDTTGLT 195
                       9****************************************999887766665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.4E-18136200IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.818138201IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-11140191No hitNo description
PfamPF001706.7E-9140188IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-10140194No hitNo description
CDDcd147033.55E-22141190No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MQDPSNPNSI KFPTTTFSAA FRPSHHRRAQ SEVNFRLPED LDLVSDPFDA PAGSFEEIGS  60
EDDFFSTYMD IEKLAGGSNP TDIDAGAARV GVESSDGEKK PRHRHSNSVD SSSLLMTESI  120
EAKKAMAPDK LAELWTIDPK RAKRILANRQ SAARSKERKT RYISELERKV QTLQAEATTL  180
STQLTLFQRD TTGLTNENTE LKLRLQAMEQ QAQLRDALNE ALKQEVERLK IATGQISASS  240
DAYSSGMQQI QYNRPAFFPH QTQPGPSESH NIQMSQFHHL QDSISNPRHP LLSGNAQALA  300
DAMQQDPLCR FQGLDISSRG SHLVKTEAPS ISASESSTTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015080651.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-105RF2B_ORYSJ; Transcription factor RF2b
TrEMBLK4C5F00.0K4C5F0_SOLLC; Uncharacterized protein
STRINGSolyc06g049040.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34252349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-109bZIP family protein