PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen07g027410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 311aa    MW: 36123.8 Da    PI: 5.419
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen07g027410.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.22.6e-11182226549
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                       kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  ++
  Sopen07g027410.1 182 KRIKRILANRQSAQRSRVRKLQYISELERSVTTLQAEVSVLSPRV 226
                       899*********************************988776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-13178242IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.576180232IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.1E-12182233No hitNo description
PfamPF001709.0E-10182225IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.29E-11182236No hitNo description
CDDcd147031.87E-21183233No hitNo description
PROSITE patternPS000360185200IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAHLPPRAPN MTQNWPDFSP HQKIETTTIS HHHHQNNPSW VDEFLDFSSS KRGSHRRSIS  60
DSIAFLEAPM VEECRIIRLS SSGTRTEFDR FDDDQLMSMF NNEDIANNNE HNSIPSSPSD  120
HNSINYEEKK LILHVEEEQQ QQQLKIEPEE VESSCKSDNE QNAAADHDDH VENSSEKIVD  180
PKRIKRILAN RQSAQRSRVR KLQYISELER SVTTLQAEVS VLSPRVAFLD HQRLVLNVDN  240
SVLKQRIAAL AQDKIFKDAH QEALKREIER LREIYYQQNL KKMENDDDDD DHSIKTQQDV  300
NGSEKKEQLV N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015080925.10.0PREDICTED: basic leucine zipper 61
SwissprotQ9M2K41e-104BZP61_ARATH; Basic leucine zipper 61
TrEMBLM1AJT90.0M1AJT9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000242890.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17752465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-101bZIP family protein