PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen07g002740.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CO-like
Protein Properties Length: 384aa    MW: 42498.7 Da    PI: 6.86
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen07g002740.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.16.4e-072561440
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkgHtvv 40
                      + C+ ++   +  fC+++++++C +C +  H +H++v
  Sopen07g002740.1 25 KSCEYCHLAAALVFCRTDNTFVCLSCDTRLHARHERV 61
                      68*****999************************976 PP

2zf-B_box21.74.1e-0761106342
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                        ++C+ +e+  ++  C+ +   lC  C   +H+       H++vp+
  Sopen07g002740.1  61 VWVCEVCEHAAASVTCRADAAALCLACDRDIHSAnplarrHERVPV 106
                       689******99*********************66899999999986 PP

3CCT69.86.7e-24305348144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Sopen07g002740.1 305 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 348
                       9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.4562263IPR000315B-box-type zinc finger
SMARTSM003366.5E-72263IPR000315B-box-type zinc finger
PfamPF006432.0E-52561IPR000315B-box-type zinc finger
CDDcd000211.81E-82763No hitNo description
PROSITE profilePS5011910.8559106IPR000315B-box-type zinc finger
PfamPF006432.3E-560106IPR000315B-box-type zinc finger
SMARTSM003362.1E-964106IPR000315B-box-type zinc finger
PROSITE profilePS5101716.638305347IPR010402CCT domain
PfamPF062038.6E-18305347IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MGIFREAPNC FPGGWNTGAA ARMAKSCEYC HLAAALVFCR TDNTFVCLSC DTRLHARHER  60
VWVCEVCEHA AASVTCRADA AALCLACDRD IHSANPLARR HERVPVVPFY DPVESVVKST  120
AATLLVSING TTTTTTTTIA PELSKVDTCI GHHENNNDPW IPPNTITSKL PLNTEMKGMD  180
FIFTDSENFL DFDYPACVDT QSQPHYNSSN DSVVPVQTNT PIKSLPFHHQ EKHFEIDFTQ  240
SHIKSYNTPS LSVSSSSLDV GIVPDGSSIS EISYPYIRTM NNSNISIDLS NSANHQGEKL  300
LGLDREARVL RYREKKKNRK FEKTIRYASR KAYAETRPRI KGRFAKRTDG SAGAGEFDDV  360
DGIFSGADFI AAESRYGVVP SFLT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6366980.0EU636698.1 Solanum lycopersicum CONSTANS-like protein mRNA, complete cds.
GenBankGQ2612280.0GQ261228.1 Solanum lycopersicum cultivar Rio Grande PtoR Hop-interacting protein THI010 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015080494.10.0zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A3Q7I0610.0A0A3Q7I061_SOLLC; Uncharacterized protein
STRINGSolyc07g006630.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-86CONSTANS-like 5