PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g032710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 752aa    MW: 85112.7 Da    PI: 5.2987
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g032710.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS362.17.7e-1113787491373
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lL++cA+ v+++d + a + L+++++++s+ gd+ qRla++f+ +L+arla++++++y+al+p++ +    +e+l+a++++  ++P+ k+
  Sopen06g032710.1 378 LRTLLVSCAQSVAADDRRTAYEQLKQIRQHCSSIGDAYQRLASVFADGLEARLAGTGTQIYAALAPKKIT---AAEKLKAYQVYLSACPFKKI 467
                       6789****************************************************************99...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       s + aN++I   +++++++H iDf+i +G+QWp L+q L++ p+gpp+lRiTg++ p++g   +e+le+tg+rLak++e+++vpfe+n+++++
  Sopen06g032710.1 468 SIFFANKMIFHTASNARTLHLIDFGILYGFQWPILIQLLSEIPDGPPKLRITGIDLPQPGfrPAESLEQTGSRLAKYCERFKVPFEYNAIATQ 560
                       ***********************************************************9******************************999 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e+++le+L++ +gE++aVn+ ++ ++llde+v l+s+rd+vL l+++++P+++v +  + +++++ F++rf eal +ys+lfd+++a+lpr
  Sopen06g032710.1 561 NWENIKLEDLKLVSGETVAVNCLFRFKNLLDETVMLDSPRDAVLGLIRKMNPDIFVQAVINGSYSAPFFVTRFREALFHYSTLFDMFDATLPR 653
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       ++++r   E+e+ +re++nv+aceg+er+er et+++W+ r ++aGFk +pl+++ +++ ++ ++  + + +  +e+ +++++gWk+r + + 
  Sopen06g032710.1 654 DDQKRLHFEQEFYRREAMNVIACEGSERVERPETYKQWQVRNMRAGFKILPLNQQLVQKLRCKVKAGYHRDFVFDEDGKWMLQGWKGRVVCAS 746
                       ******************************************************************99999********************** PP

              GRAS 371 SaW 373
                       S+W
  Sopen06g032710.1 747 SCW 749
                       *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.935352730IPR005202Transcription factor GRAS
PfamPF035142.7E-108378749IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MDPRFIPLSD PVNTFEFEDQ INLSSYEGSL NPPHNYNDDY VGFGVPYTAP TVDIGNFAPS  60
SNVSSEVDSP DDHDSDSLFK YLNQILMEEN IEDKPSMFHD PLALKAAEKS LYEALGKSYP  120
PSPYRTPYHV DHRLESPSPD SIFQTSSDHS TSSSNAHSNS MDPHWIVDPG ESSLSLPVES  180
HPSEYSIQPL MQSNSERSHG SLNNINNLNV HMDSFLNPYA LSNMFTDSES ILQFKRGVEE  240
ANKFLPNVSQ FVVDLDKYTF PPKVEEVTKE AVVKVEKDER NHSPNGTKGR KHQYPEDSDF  300
EDERSNKQSA IYVEEEAELS EMFDRVLLCT DKGETICGDV KCEMPVDNSL DQNGQAHGSN  360
GGKTRAKKQG TKNEAVDLRT LLVSCAQSVA ADDRRTAYEQ LKQIRQHCSS IGDAYQRLAS  420
VFADGLEARL AGTGTQIYAA LAPKKITAAE KLKAYQVYLS ACPFKKISIF FANKMIFHTA  480
SNARTLHLID FGILYGFQWP ILIQLLSEIP DGPPKLRITG IDLPQPGFRP AESLEQTGSR  540
LAKYCERFKV PFEYNAIATQ NWENIKLEDL KLVSGETVAV NCLFRFKNLL DETVMLDSPR  600
DAVLGLIRKM NPDIFVQAVI NGSYSAPFFV TRFREALFHY STLFDMFDAT LPRDDQKRLH  660
FEQEFYRREA MNVIACEGSE RVERPETYKQ WQVRNMRAGF KILPLNQQLV QKLRCKVKAG  720
YHRDFVFDED GKWMLQGWKG RVVCASSCWV PA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-433617511379Protein SCARECROW
5b3h_D1e-433617511379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015079928.10.0scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM1CZ550.0M1CZ55_SOLTU; Uncharacterized protein
STRINGSolyc06g076280.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]