PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g018410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 434aa    MW: 47462.5 Da    PI: 6.4107
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g018410.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.53.8e-10226284563
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l +e+
  Sopen06g018410.1 226 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSTQLTLLQRDTNGLNAEN 284
                       9********************************************99998877776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-15222286IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.932224287IPR004827Basic-leucine zipper domain
PfamPF001705.6E-9226282IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11226277No hitNo description
Gene3DG3DSA:1.20.5.1701.9E-10226280No hitNo description
CDDcd147037.02E-19227263No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MDKDKSSSSH VGGSLPPSGR YSLFSPPGSS SNVKSEQPGL ANLPPLGPGN ASESGHFGHG  60
LSADSSLFSL DISRMSDNPP RKFGHRRAHS EILTLPDDIS FDSDLGVVGL DGPSLSDETE  120
EDILSMYLDM DKFNSSTLSS EFQVGESSSA APGSSQTPAM ASGTNKFAPT VSEKPRVRHQ  180
HSQSMDGSTT IKPEMLMSGV EEPSSAETKK ATSAAKLAEL ALIDPKRAKR IWANRQSAAR  240
SKERKMRYIA ELERKVQTLQ TEATTLSTQL TLLQRDTNGL NAENSELKLR LQTMEQQVHL  300
QDALNDALKE EIQHLKVLTG QGIANGGPMM NFPATFGGNQ QFYSNNQAMH TLLAAQQLQQ  360
LQLHSHKQQH QFQQHQLHQF QQQQLQHQQQ QQQPLMQQQQ QQDQLSQAGD VMSRGSLSSP  420
QNENASDGSS VAKD
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0134850.0BT013485.1 Lycopersicon esculentum clone 132168R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015079958.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-146POF21_ARATH; Probable transcription factor PosF21
TrEMBLK4C6220.0K4C622_SOLLC; Uncharacterized protein
STRINGSolyc06g053350.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39652137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-124bZIP family protein