PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g011970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 594aa    MW: 65534.8 Da    PI: 6.5897
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g011970.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS340.62.7e-1042265933373
              GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                       + ++e+A+a+ +g+++ a ++L+rl + a  +g++ qRl ay++ AL++r+++    +    p+ e    +s+e++ + + ++e+sP++k+++
  Sopen06g011970.1 226 QSIVEAATAIIDGKTNVAVQILTRLAQVADVRGSSEQRLMAYMVSALRSRVNS----TEYPPPVME---LHSKEHAVSAQNLYEISPCFKLGF 311
                       6789************************************************9....222233333...358899999999************ PP

              GRAS  96 ltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg.skeeleetgerLakfAeelgvpfefnvlvak 184
                       ++aN aI+eav+ +  +++H+iDfdi+qG+Q++ Ll+aLas++ + p slRiT++  + ++   ++l+++++ L+++A+++g+++ f+v ++ 
  Sopen06g011970.1 312 MAANFAIVEAVADHpsNKIHVIDFDIGQGGQYLHLLHALASKKTDYPiSLRITAITTEFTVrADNSLKSIEDDLRSLANKIGISLIFKV-ISC 403
                       ************9999************************99977776*********87778999***********************9.699 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       +++dl+ e+L ++++EalaVn++++l+rl+desv++e+ rde+L+ vk+lsPkvv++veqe++ n++ F++r+ ea+ yy al+dsl+a+++r
  Sopen06g011970.1 404 TITDLSREKLGIEHDEALAVNFAYRLYRLPDESVTTENLRDELLRRVKGLSPKVVTLVEQELNGNTAAFVARVNEACGYYGALLDSLDATVSR 496
                       9******************************************************************************************** PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk..sdgyrveeesgslvlgWkdrpLv 368
                       e+  r+k+E+  l+r+++n vaceg++r er+e ++kWr+r+++aGF+p p+s+++a++    l+  +  + g++v+e+sg + +gW++++L+
  Sopen06g011970.1 497 EETGRVKIEEG-LSRKLTNSVACEGRDRLERCEVFGKWRARMSMAGFGPRPMSQQIADSLLKRLNSGPrgNPGFNVNEQSGGIRFGWMGKTLT 588
                       ***********.*******************************************999987777766557899******************** PP

              GRAS 369 svSaW 373
                       ++SaW
  Sopen06g011970.1 589 VASAW 593
                       ***** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.894198572IPR005202Transcription factor GRAS
PfamPF035149.4E-102226593IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MSSDFSGGFP DFHGGAGRSN LIPMNNSQPQ IQLDGASQNL RRRPTFIGKR SLAAFQQQQQ  60
FQFLQQQQQQ QGLGFYLRNV KPRNYQQASP ISPLDYSVSS SLISSEFSPM TPRHPLPIST  120
ANTNGVLSSG NPNCSAVASY LNQVQNSLYQ ESEEKMMNRL HELEKQLLED NNEEEEDTVS  180
VVTNNDEWSE TIKNLITPTS NHLSPASSTS SCSSSMESPP VSSPKQSIVE AATAIIDGKT  240
NVAVQILTRL AQVADVRGSS EQRLMAYMVS ALRSRVNSTE YPPPVMELHS KEHAVSAQNL  300
YEISPCFKLG FMAANFAIVE AVADHPSNKI HVIDFDIGQG GQYLHLLHAL ASKKTDYPIS  360
LRITAITTEF TVRADNSLKS IEDDLRSLAN KIGISLIFKV ISCTITDLSR EKLGIEHDEA  420
LAVNFAYRLY RLPDESVTTE NLRDELLRRV KGLSPKVVTL VEQELNGNTA AFVARVNEAC  480
GYYGALLDSL DATVSREETG RVKIEEGLSR KLTNSVACEG RDRLERCEVF GKWRARMSMA  540
GFGPRPMSQQ IADSLLKRLN SGPRGNPGFN VNEQSGGIRF GWMGKTLTVA SAWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4125159324374GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015077266.10.0scarecrow-like protein 8
TrEMBLA0A3Q7GUI20.0A0A3Q7GUI2_SOLLC; Uncharacterized protein
STRINGSolyc06g036170.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40232443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-135SCARECROW-like 8