PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g011390.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 501aa    MW: 56350.8 Da    PI: 5.558
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g011390.2genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS337.22.8e-10318149846365
              GRAS  46 teALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpeg 138
                        e+L +r   s++++y++l+++e +    ++ ++++ +++e++P+lkf++++aN aI+ea  +e+r+HiiDf+i qG+QW+ +lqaLa+Rp+g
  Sopen06g011390.2 181 QEGLVERKKLSGTTIYRSLKCKEPA---GKDLFSYMYILYEICPYLKFGYMAANGAIVEACRNEDRIHIIDFQIAQGTQWMIFLQALAARPGG 270
                       688888888899************9...99999999********************************************************* PP

              GRAS 139 ppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLk 229
                       +p +RiTg+++p s+  + + l ++++rL+ + ee+++ + f+++      +++ ++L+v+pgEa aVn+ lqlh+++desv+ +++rd +++
  Sopen06g011390.2 271 APYVRITGIDDPVSQyaRVDGLAAVARRLSAISEEFNIAVAFHAV-PVFALEITWDMLDVRPGEAQAVNFPLQLHHTPDESVDANNPRDGLIR 362
                       ************999999**************************5.66666788*************************************** PP

              GRAS 230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                       ++ksl Pk+v++veqe+ +n+++Fl rf+eal+yy a+f+s++++l r+ +eri+vE+++l+ +ivnv+aceg+er+erhe l+kW++r+++a
  Sopen06g011390.2 363 MIKSLCPKIVTLVEQESHTNTAPFLPRFVEALDYYHAMFESIDVTLQRDMKERITVEQHCLAMDIVNVIACEGKERVERHELLGKWKSRFMMA 455
                       ********************************************************************************************* PP

              GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveeesgslv.lgWkdr 365
                       GF+++pls+++++ +k l+++++ d y++ e++g+++  +W +r
  Sopen06g011390.2 456 GFQQYPLSSFVNSVIKDLMKRYS-DHYTLVEQDGAMLiCCWGGR 498
                       ***********************.66**9999999886899887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.387100487IPR005202Transcription factor GRAS
PfamPF035149.9E-101181498IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MDSHHLVAYG VTGSDLSYSS YPTVSPLENR PFGTSKFDSG NSPLVNYFYS ETFNTVSDYQ  60
EQHSCTENLS GASSSSGSTL DCNQYFHRPS PSEDHLPEAP YSRNMKHTLL QLESALMGPD  120
EEAMKSSPYL GENMGAQTSG QRYKAWNKEA QVVHHQQSVV SILNGIQSDK RDNVMEDLPL  180
QEGLVERKKL SGTTIYRSLK CKEPAGKDLF SYMYILYEIC PYLKFGYMAA NGAIVEACRN  240
EDRIHIIDFQ IAQGTQWMIF LQALAARPGG APYVRITGID DPVSQYARVD GLAAVARRLS  300
AISEEFNIAV AFHAVPVFAL EITWDMLDVR PGEAQAVNFP LQLHHTPDES VDANNPRDGL  360
IRMIKSLCPK IVTLVEQESH TNTAPFLPRF VEALDYYHAM FESIDVTLQR DMKERITVEQ  420
HCLAMDIVNV IACEGKERVE RHELLGKWKS RFMMAGFQQY PLSSFVNSVI KDLMKRYSDH  480
YTLVEQDGAM LICCWGGRSG I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-4921649883366GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015059336.10.0scarecrow-like protein 21
SwissprotQ69VG11e-168CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLG8Z2670.0G8Z267_SOLLC; Hop-interacting protein THI039
STRINGSolyc12g005340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34412448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-140GRAS family protein
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]