PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g011390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 472aa    MW: 53012.8 Da    PI: 5.5508
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g011390.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS288.22.3e-88206469103365
              GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                       +ea  +e+r+HiiDf+i qG+QW+ +lqaLa+Rp+g+p +RiTg+++p s+  + + l ++++rL+ + ee+++ + f+++      +++ ++
  Sopen06g011390.1 206 VEACRNEDRIHIIDFQIAQGTQWMIFLQALAARPGGAPYVRITGIDDPVSQyaRVDGLAAVARRLSAISEEFNIAVAFHAV-PVFALEITWDM 297
                       7999********************************************999999**************************5.66666788*** PP

              GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                       L+v+pgEa aVn+ lqlh+++desv+ +++rd +++++ksl Pk+v++veqe+ +n+++Fl rf+eal+yy a+f+s++++l r+ +eri+vE
  Sopen06g011390.1 298 LDVRPGEAQAVNFPLQLHHTPDESVDANNPRDGLIRMIKSLCPKIVTLVEQESHTNTAPFLPRFVEALDYYHAMFESIDVTLQRDMKERITVE 390
                       ********************************************************************************************* PP

              GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv.lgWkdr 365
                       +++l+ +ivnv+aceg+er+erhe l+kW++r+++aGF+++pls+++++ +k l+++++ d y++ e++g+++  +W +r
  Sopen06g011390.1 391 QHCLAMDIVNVIACEGKERVERHELLGKWKSRFMMAGFQQYPLSSFVNSVIKDLMKRYS-DHYTLVEQDGAMLiCCWGGR 469
                       ***********************************************************.66**9999999886899887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.42579458IPR005202Transcription factor GRAS
PfamPF035147.9E-86206469IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MDSHHLVAYG VTGSDLSYSS YPTVSPLENR PFGTSKFDSG NSPLVNYFYS ETFNTVSDYQ  60
EQHSCTENLS GASSSSGSTL DCNQYFHRPS PSEDHLPEAP YSRNMKHTLL QLESALMGPD  120
EEAMKSSPYL GENMGAQTSG QRYKAWNKEA QVVHHQQSVV SILNGIQSDK RDNVMEDLPL  180
QEGLVERKKL SGTTIYRSLK CKEPAVEACR NEDRIHIIDF QIAQGTQWMI FLQALAARPG  240
GAPYVRITGI DDPVSQYARV DGLAAVARRL SAISEEFNIA VAFHAVPVFA LEITWDMLDV  300
RPGEAQAVNF PLQLHHTPDE SVDANNPRDG LIRMIKSLCP KIVTLVEQES HTNTAPFLPR  360
FVEALDYYHA MFESIDVTLQ RDMKERITVE QHCLAMDIVN VIACEGKERV ERHELLGKWK  420
SRFMMAGFQQ YPLSSFVNSV IKDLMKRYSD HYTLVEQDGA MLICCWGGRS GI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4119946995366GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015059336.10.0scarecrow-like protein 21
SwissprotQ69VG11e-142CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1
TrEMBLG8Z2670.0G8Z267_SOLLC; Hop-interacting protein THI039
STRINGSolyc12g005340.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.21e-116GRAS family protein
Publications ? help Back to Top
  1. Day RB, et al.
    Two rice GRAS family genes responsive to N -acetylchitooligosaccharide elicitor are induced by phytoactive gibberellins: evidence for cross-talk between elicitor and gibberellin signaling in rice cells.
    Plant Mol. Biol., 2004. 54(2): p. 261-72
    [PMID:15159627]