PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g004240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 849aa    MW: 96160.7 Da    PI: 5.573
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g004240.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.51e-924798471374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilk 92 
                       lv+lLl++Ae v++++++la++ +a+    as +g+p+qRl +yf eAL++r+ r  + + +   + +  s+    ++  +l + +   P+ +
  Sopen06g004240.1 479 LVHLLLAAAEEVDQQQFHLASQSIAQCLWKASATGNPIQRLCFYFGEALQERIDReIGRSPCFERKLRFLSTLALGNTPESL-TCHTEIPFSQ 570
                       68*****************************************************322221111222222222233333333.355667**** PP

              GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                       + +++ NqaI+e v+g++++H +Df+i  G+QW  L+qaL++R++ p   l+iT++g+   ++ke++eetg+rL++fA++l++pf+f+++ ++
  Sopen06g004240.1 571 VMQFAGNQAIVEYVKGATKIHLVDFNIRSGIQWTGLMQALSERRNCPIeLLKITAIGH---QEKEKIEETGKRLQSFANSLNLPFSFDMIFMS 660
                       *****************************************9996665499*******...579***************************** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       +++dl+ e+ ++k +E++aV +   l ++     + +++ d++++++++l+P vvvv+e ea++ns+sFl+rf+eal +ys+lfd++e  + r
  Sopen06g004240.1 661 DMKDLKAESVNLKADETVAVYCYTVLRTMI----CRQDYLDNTMRVIRGLRPSVVVVCEVEANLNSPSFLNRFVEALFFYSVLFDCFEDCMDR 749
                       ************************999998....77778888*************************************************** PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvs 369
                       ++  r+ +E + +g+ i n+va+egaer+ r+ +l  Wr+ + ++G+ +++lse+   qa+l+l++++ +    v+++ ++l+ gWk+ p+ s
  Sopen06g004240.1 750 DNLVRKRIEVFHIGEGIWNMVAAEGAERFTRNVKLDVWRAYFARFGMVEMELSESSRYQANLILKQFShGSSCIVQKDGKALLVGWKGTPIES 842
                       ********************************************************************777788999999999********** PP

              GRAS 370 vSaWr 374
                       vS W+
  Sopen06g004240.1 843 VSIWK 847
                       ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.259453826IPR005202Transcription factor GRAS
PfamPF035143.5E-90479847IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 849 aa     Download sequence    Send to blast
MGSSSKFYVS VSKGYVVNML RESFQCLTII LLSLLLPLSF IVLARLSVTR YLIATSDYTE  60
PNTLLVKLFL YANPVFLRLL TPLVTISALT QCLTGRTLTD HIMISKSHLY MSWLILFTFQ  120
ICVSIGIEGS IAVGIDGSTS FSHQRLYLLT RSLFFMGLHE TTLFWSKKVV KPVVDDTIFG  180
VEKEDRYVEK VAMAMSFGIL WWCKLGDEVE SLVVVAEVKR DLFGSVGLVD FVGWWLYYVT  240
VAIGMVKVVK GLIWLNFVLF CGNMVVGSDN AGCCTRNDEK GGHNHVQECG RNELINNVAV  300
DPWFELDSED LDSLYTVFDL KYQDNTSDKQ VQSLEDQQQS ISDHWTQSDD SSNMDLPLQP  360
IQIKTTPEAS NGIQPQEPRL DNFHGEKTNS ISLASLEILN NCGRLFKKPS EENLSNVLLS  420
NEARVSNISK LSTEEILRVA GERYIQYSTQ RVDGLSMFIH PYASSLSGLS IEQTKDMELV  480
HLLLAAAEEV DQQQFHLASQ SIAQCLWKAS ATGNPIQRLC FYFGEALQER IDREIGRSPC  540
FERKLRFLST LALGNTPESL TCHTEIPFSQ VMQFAGNQAI VEYVKGATKI HLVDFNIRSG  600
IQWTGLMQAL SERRNCPIEL LKITAIGHQE KEKIEETGKR LQSFANSLNL PFSFDMIFMS  660
DMKDLKAESV NLKADETVAV YCYTVLRTMI CRQDYLDNTM RVIRGLRPSV VVVCEVEANL  720
NSPSFLNRFV EALFFYSVLF DCFEDCMDRD NLVRKRIEVF HIGEGIWNMV AAEGAERFTR  780
NVKLDVWRAY FARFGMVEME LSESSRYQAN LILKQFSHGS SCIVQKDGKA LLVGWKGTPI  840
ESVSIWKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-4749784721375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015078169.10.0DELLA protein RGL1-like
TrEMBLK4C3Z10.0K4C3Z1_SOLLC; Uncharacterized protein
STRINGSolyc06g009610.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-49RGA-like 1