PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen06g003210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 282aa    MW: 32443.4 Da    PI: 6.0454
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen06g003210.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.94.8e-50101381129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrF P+deel+++yL kk++++++    ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat sgyWkatgkd++v+
  Sopen06g003210.1  10 LPPGFRFYPSDEELISHYLYKKIANQEVIK-GTLVEIDLHTCEPWQLPEVAKLNSNEWYFFSFRDRKYATGFRTNRATISGYWKATGKDRTVF 101
                       79************************9555.78***************88888999************************************* PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                       +  +g+l+g++ktLvfyk+rap+g kt W+mhe+rle
  Sopen06g003210.1 102 DPqTGALIGMRKTLVFYKNRAPHGIKTGWIMHEFRLE 138
                       9867889***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-618156IPR003441NAC domain
PROSITE profilePS5100558.10810156IPR003441NAC domain
PfamPF023654.9E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGLRDIGSSL PPGFRFYPSD EELISHYLYK KIANQEVIKG TLVEIDLHTC EPWQLPEVAK  60
LNSNEWYFFS FRDRKYATGF RTNRATISGY WKATGKDRTV FDPQTGALIG MRKTLVFYKN  120
RAPHGIKTGW IMHEFRLENP HIPPKEDWVL CRVFFKGTKD ENIHSTNNES TSITSFNMDN  180
HEGTMPKLLS YGGGEYRPST LPNFSNNSIY QNQNSSNNLQ LSQEINKVLA NEIIHSKCGK  240
EDEFGFLFDM NYFEESSLQD GGVHSCLDGD MKFEDENSLV FI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-47915614168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015078256.10.0protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ9S8511e-63NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A3Q7HJG60.0A0A3Q7HJG6_SOLLC; Uncharacterized protein
STRINGSolyc06g008360.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.13e-90NAC domain containing protein 74
Publications ? help Back to Top
  1. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  2. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  3. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  4. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  5. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]