PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen05g006290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 194aa    MW: 22474.2 Da    PI: 6.3024
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen05g006290.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.43.7e-1480138563
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       ++ rr+++NRe+ArrsR RK+ +++eL   v  L +eN+ L+++l++ ++  +k+ +e+
  Sopen05g006290.1  80 RKKRRMISNRESARRSRMRKQRQLDELWSQVVRLRTENHNLIDKLNHVSECHDKVLQEN 138
                       6889*******************************************999888888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-1576140IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.61178141IPR004827Basic-leucine zipper domain
PfamPF001703.7E-1280138IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-1280153No hitNo description
SuperFamilySSF579594.97E-1280129No hitNo description
CDDcd147025.25E-2081132No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MIPSEAAATH YFASQNPSPL PLDFNFMQNN LPSLHFSRYL TNILPNYPVN DFNNLIPSCI  60
SGNSTSDETD EQQLKIIDER KKRRMISNRE SARRSRMRKQ RQLDELWSQV VRLRTENHNL  120
IDKLNHVSEC HDKVLQENAQ LKEETSDLRQ MLTDLQFNSP FPDLCELEDV PCTTAHLKAE  180
SSNLSITHST NLLH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19299RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015075661.11e-142PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC23e-39BZP43_ARATH; Basic leucine zipper 43
TrEMBLM1AC521e-133M1AC52_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000194651e-133(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.16e-48basic leucine-zipper 42