PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g034330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 146aa    MW: 17110.3 Da    PI: 8.4145
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g034330.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.24.2e-142785563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                      ++ +r+q+NRe+ArrsR RK++ ++ L   v +L++eN+   + + + ++++ ++++e+
  Sopen04g034330.1 27 RKRKRMQSNRESARRSRMRKQKHLDDLMCQVTQLKKENSNILSSITMTTQQYGNVEAEN 85
                      5789******************************************9999999888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.8E-202387IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-112580No hitNo description
PROSITE profilePS5021710.8982588IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.31E-122778No hitNo description
PfamPF001709.3E-112781IPR004827Basic-leucine zipper domain
CDDcd147022.78E-192878No hitNo description
PROSITE patternPS0003603045IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MATSSGNSSQ IPNNSASDEV FMVVDERKRK RMQSNRESAR RSRMRKQKHL DDLMCQVTQL  60
KKENSNILSS ITMTTQQYGN VEAENSVLRA QMMELTQRLQ SLNEILTYIN NSNINTYYQE  120
DFQMNPWNLM YVNQPIMASS DMLYQY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12647RKRKRMQSNRESARRSRMRKQK
23946RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015074279.11e-104PREDICTED: bZIP transcription factor 53-like
SwissprotQ9LZP81e-31BZP53_ARATH; bZIP transcription factor 53
TrEMBLK4BVF31e-95K4BVF3_SOLLC; Uncharacterized protein
STRINGSolyc04g080740.1.14e-95(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53724123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.15e-46basic leucine-zipper 44