PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g033400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 691aa    MW: 77935.7 Da    PI: 6.9549
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g033400.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.5e-094905271954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yps++++  L++++gL+++qV++WF N R +
  Sopen04g033400.1 490 FEHflHPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 527
                       554459******************************88 PP

2BELL111.44.9e-36350421172
              BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       er e q++k kLls+l+eVd rY +y+eq+q++++sF+ v+g+g+a+pYt+lA+ka+SrhFrc+kdai++q+
  Sopen04g033400.1 350 ERSEYQRRKIKLLSMLDEVDARYTRYCEQMQAMVNSFDSVIGYGAAAPYTALAQKAMSRHFRCIKDAIVGQL 421
                       789******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-55282419IPR006563POX domain
PfamPF075261.6E-48288418IPR006563POX domain
PROSITE profilePS5007112.422468531IPR001356Homeobox domain
CDDcd000861.08E-11471532No hitNo description
SMARTSM003891.8E-9471535IPR001356Homeobox domain
SuperFamilySSF466897.27E-17472538IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28474537IPR009057Homeodomain-like
PfamPF059207.6E-18488527IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MSHSFHQHQG FYNFSNVYER SATTTTKHED MLRVQGFEPQ QVEVAAAAVE PPPTATVYDD  60
GGMLTEIISY PTAWRKTATE ILDDQIQSSN YRSWPQKEQQ HLQQQQQQLL PQSIINDTEL  120
PLMNPHIKPS SPPRSSSSLH MLLPNSVDTN NLLHHQGFHL LNPAPVETPS QFTWVPGSSS  180
GEDNSARIGR VVDGQGLSLS LSRNFEAAAK LEDLRIGNGE IYLHNNQGLL GPINNNNNHH  240
HHHQLLHSGV IMDHRTPPHP LPPHTSTGHH HQIHVGYAAS SPRISNALRN SRYVKATQEL  300
LEEFCCVGRG NFKNQRVKKL DDDQNPNSNS ESEDHRGPSK DNHPPLSAAE RSEYQRRKIK  360
LLSMLDEVDA RYTRYCEQMQ AMVNSFDSVI GYGAAAPYTA LAQKAMSRHF RCIKDAIVGQ  420
LKQTCKYLGE KDVTGTSGLT KGETPRLKML DQKLRQQKAL HQMGMLDSDA WRPQRGLPER  480
SVNVLRAWLF EHFLHPYPSE ADKHLLSRQT GLSKNQVSNW FINARVRLWK PMVEEMYQQE  540
TKEEEIDQEE EEEQEQQQQE KQAQIPMHNM ATSPAATTTK TTTISLSSSV RSKFNANERD  600
PSENIINYRQ YALGNQLVML QSDDTATAST SNHHYFTAVN AVDLVANPNA ANTAAFGSQQ  660
AGDVSLTLGL RHSDNVPRKP TQFQLRDFGA Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16477535563Homeobox protein Meis2
3k2a_B2e-16477535563Homeobox protein Meis2
4xrm_A2e-16477535563Homeobox protein Meis2
4xrm_B2e-16477535563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015073724.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-135BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLK4BV620.0K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-121BEL1-like homeodomain 2