PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g032440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 447aa    MW: 48042.8 Da    PI: 9.9469
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g032440.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.42.1e-15369420556
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                       +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+ ee+ ++ 
  Sopen04g032440.1 369 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENDELQKKQEEMLEMQ 420
                       79***************************************98888776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.2E-14365430IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.45367416IPR004827Basic-leucine zipper domain
PfamPF001705.5E-13369421IPR004827Basic-leucine zipper domain
CDDcd147075.70E-30369423No hitNo description
SuperFamilySSF579592.95E-11369418No hitNo description
Gene3DG3DSA:1.20.5.1707.2E-15369418No hitNo description
PROSITE patternPS000360372387IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MGSNYHFKNF GNEPPGEGGS GGGGKQPGNF GLPRQPSIYS LTFDEFLSST GGSGKDFGSM  60
NMDELLKNIW NAEENQTIGG PGINGQEVGV PGGHLQRQGS LTLPRTLSHK TVDEVWRDMS  120
KEHGGGKDGN SVGVPPNIPQ TQRQQNLGEI TLEEFLVRAG VVREDAQFAA KSNNAGGIFG  180
DLSYAGNNTG LAFGYQQANS RNTGLMPGSI PNKNGETVIQ SANLPLNVNG VRSTQQQLRP  240
QQLQQNQQSQ PQQQPIFPKQ PALPYGAPMA IPNSGQLSSP GMRAGMVGIP DPALNSNFIQ  300
GASLMGGGMN MVGLGASGVT VATASPGVSS SDGLGKSNGD TPSVSPVPYV FNGGLRGRKY  360
STVEKVVERR QRRMIKNRES AARSRARKQA YTMELEAEVA KLKEENDELQ KKQEEMLEMQ  420
KNQVMEMMNL QKGAKRRCLR RTQTGPW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5307580.0AY530758.1 Lycopersicon esculentum AREB-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015074141.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
RefseqXP_015074142.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
RefseqXP_015074143.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q41e-131AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLQ6QPK10.0Q6QPK1_SOLLC; AREB-like protein
STRINGSolyc04g078840.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7762497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-113abscisic acid responsive elements-binding factor 2