PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g028640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 363aa    MW: 41142.9 Da    PI: 7.9977
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g028640.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.54.6e-1179109333
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLee 33 
                       ++k++rr+++NReAAr+sR RKka++++Le+
  Sopen04g028640.1  79 SDKVQRRLAQNREAARKSRMRKKAYVQQLET 109
                       79***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.4E-1077121No hitNo description
SMARTSM003386.2E-677137IPR004827Basic-leucine zipper domain
PfamPF001701.1E-779111IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.00279123IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.81E-781116No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
PfamPF141445.1E-29167240IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MNMTSPTTQF APTRRMGIYE PFHQMSVWED AFRGDIMPSA DACMVSHPND RPDDKSGYTS  60
GEQHMPSGSG DNQGPRSSSD KVQRRLAQNR EAARKSRMRK KAYVQQLETS RLKLAQLELE  120
LERARQQGLY MLGSNSNMGL LGTINPGIAA FEIEYSHWVE EQQKKNAELR SILQSPVSDM  180
ELQLLVENVL SHYFNLFRMK ADAAKADVFY LMSGMWRTSV ERFFLWIGGF KPSELINVVM  240
PQLEPLADQQ IIKVCNLRHC CQQAEDALTQ GMDKLQQTLA QSILNMNTGA GNYTSQMVSS  300
MENLEALESF VNQADHLRQQ TLQQMSIILS THQAARGLLA FGEYVQRLRA LSSLWAARPR  360
KPT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0142160.0BT014216.1 Lycopersicon esculentum clone 133394F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015071682.10.0PREDICTED: transcription factor TGA4-like isoform X1
RefseqXP_015071683.10.0PREDICTED: transcription factor TGA1-like isoform X2
RefseqXP_015071684.10.0PREDICTED: transcription factor TGA1-like isoform X2
SwissprotQ392371e-153TGA1_ARATH; Transcription factor TGA1
TrEMBLK4BTN30.0K4BTN3_SOLLC; Uncharacterized protein
STRINGSolyc04g072460.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-141TGACG motif-binding factor 4