PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g027480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 307aa    MW: 33701 Da    PI: 7.2727
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g027480.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.22e-14224273251
                       XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                       ++l+r+rr++kNRe+A rsR+RK+a++ eLe  +  Le+eN++L ke ee
  Sopen04g027480.1 224 AALQRQRRMIKNRESAARSRERKQAYQVELESIAVRLEEENEQLLKEKEE 273
                       689*****************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-9223285IPR004827Basic-leucine zipper domain
PfamPF001703.7E-13224273IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.45225276IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-9227277No hitNo description
CDDcd147072.24E-16227273No hitNo description
Gene3DG3DSA:1.20.5.1705.1E-12228274No hitNo description
PROSITE patternPS000360230245IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MASTKLMASS ASRNSDRRKS SAASSSSSST MPNDLLNQQY SNNGSNNSSN LEATSMTVDG  60
FLRNVYGEGQ GTEATLLNAN ITLLDAAGAI TPISDSDTAT VSGIPLVRRT VDDVWREIVE  120
GKREQRRAAV AGCKEEAVDE IMTLEDFLVK AGAVEEEALA GEGPVQGEVK VELGTERLSG  180
GIFAFDSPYM ATPQQSVQGY GNGIDVIGGG RGKRKAILEP LDKAALQRQR RMIKNRESAA  240
RSRERKQAYQ VELESIAVRL EEENEQLLKE KEERTRAHYK QIIEKVIPVV EKRKPPRVLR  300
RVCSMLW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015071730.10.0PREDICTED: G-box-binding factor 4
SwissprotP427771e-51GBF4_ARATH; G-box-binding factor 4
TrEMBLK4BTE30.0K4BTE3_SOLLC; Uncharacterized protein
STRINGSolyc04g071510.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27712452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.15e-44bZIP family protein