PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g025360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 642aa    MW: 71227.6 Da    PI: 7.8974
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g025360.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.83.5e-11157212560
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                       kr  rk++N+++A  sRqRKk +++eLe+k+  + +  + L  +l+    e  +lk
  Sopen04g025360.1 157 KRMDRKIRNKVSAHLSRQRKKHYVKELENKFRIFHSTIQHLNANLSYAMAENITLK 212
                       8999****************************999999888887776655555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.3E-9153217IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.002155215IPR004827Basic-leucine zipper domain
PfamPF001706.9E-9157214IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-12157215No hitNo description
SuperFamilySSF579596.35E-10157215No hitNo description
CDDcd147048.22E-14158208No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MADPPPAEET NFIGEFDALA VQPLDRTFNA LHMTATYQEN VEDFPIEFQN VNFKTDDIIL  60
YESFNDIFPN PTNDDAFQNP SCLPDFLGSE LGLDSSQMNP HSFCQPESQL MGIPDDASRP  120
FNSTSEYCLG KAPVSNKLEH FPLNLGNNSV KGGVDEKRMD RKIRNKVSAH LSRQRKKHYV  180
KELENKFRIF HSTIQHLNAN LSYAMAENIT LKAQLGGNGV PTQVPPPLGI NPYPPPWMSY  240
TPYYMMNRQG YQVPLVPIPK LKSQALAPAP KSNKEVEKKK SGVKTKKVVS VSFLGVLFFI  300
LLFGGLVPLL KGRYGDMREP FMSGESFVSG FYEKHHERVL TIDEPVNGTG YSGKYDGKNH  360
SSHCGQRGQG ESNKQNTNKA GDEFVHVGNG SDPLVASLYV PRNDKLVEID GSLIIQSILA  420
SEKAMAFHGS AEKKNKEAGL AVPGDIAPTI PAVHPRLYRS PEVGQRTLGS DENENVKSTI  480
LRWYLEGVAG PLLSSGMCTE VFQFDASSSA REAIVPVTNV RDTSMEERHN DTRLHRNRRI  540
LNGPPVSLSR PSHNISEEQT GTNGKQENPN RNKSLSSLVV SVLVDGDGDG IMRPKSVSRI  600
FVLVLIDSVK YVTNSCMLPF IDSAHVARAS SKKQFCRYHK IY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015072739.10.0PREDICTED: bZIP transcription factor 17-like
TrEMBLM1DJZ60.0M1DJZ6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000902490.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30292450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.12e-80bZIP family protein