PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g001180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 191aa    MW: 22351.7 Da    PI: 6.2468
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g001180.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.11e-1481140564
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 
                       +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN+ L+++l++ ++  +++ +e++
  Sopen04g001180.1  81 RKQRRMISNRESARRSRMRKQRHLDELWSQVVRLRTENHNLINKLNQVSESHEQVVQENM 140
                       79************************************************9999998885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-1677141IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.20879142IPR004827Basic-leucine zipper domain
PfamPF001701.5E-1281140IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.8E-1281135No hitNo description
SuperFamilySSF579598.44E-1381131No hitNo description
CDDcd147023.28E-1982132No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MISSEAATIH YLAQENPSSL PIDYTFMHKN FQFNNTFLTN NYQSFTFPIQ DLISTQPASC  60
ISSNSTSDES EEQQHRIIDE RKQRRMISNR ESARRSRMRK QRHLDELWSQ VVRLRTENHN  120
LINKLNQVSE SHEQVVQENM QLKDEAYDLR RLLVDIQVAT PFNGFSNIDD NVPSSLKTES  180
SNQSTTERKL E
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
193100RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015073036.11e-139PREDICTED: basic leucine zipper 43
TrEMBLK4BNC31e-136K4BNC3_SOLLC; Uncharacterized protein
STRINGSolyc04g005170.1.11e-136(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.15e-48basic leucine-zipper 42