PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g033930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family SBP
Protein Properties Length: 525aa    MW: 57267.8 Da    PI: 9.0393
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g033930.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.24.2e-42168243277
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                       Cqv+gC +dls +k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+ 
  Sopen03g033930.1 168 CQVQGCGKDLSPCKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPP 243
                       **************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.5E-34162229IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.701165242IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.06E-39166245IPR004333Transcription factor, SBP-box
PfamPF031101.3E-31168241IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MESWSYFSGG KGFVSEESVS VNDGMGRVKN GVMGWELKTQ SSYGMCTTDN QGFHDLGSPN  60
LMRKPMFTDQ MRDGFTSSSK HWGGGGGSIF GAFSGEDKSS SKLSSSAVDS ISRDSSLIDL  120
KLGRFPDHHV DGNIFKSAKS LSSSTSAESV VPAKRMRAGG LNSHKPFCQV QGCGKDLSPC  180
KDYHKRHKVC EVHSKTAKVI VNGIEQRFCQ QCSRFHLLAE FDDGKRSCRK RLAGHNERRR  240
KPPHTGTRFR GTSFATSPFA CQDILSSRYL HQPKYEMSDW YKNVKVEDGV DYSPQLAMPF  300
TNGQLQPKSH FTSYHAKKGC HSFHDGLPAV TTSRINESTN SSLHDMRGSD FVSPSLFHIT  360
STGSEVLHAL DTSSIQGLSG ISNSSNALSL LSSQSQGSSN HCTVFSTSRP LIQPNNNYNV  420
TQASKNVLGL GPQASAGRMS NTFNSSGVNS SEGGLDQMIF PSNTCGINRV IQGSDLVNPK  480
NQLSCEDGPT IDLLQLSSQL QRVEHQRFSV QVKQDGNAFP GLRIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-291672411084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0134570.0BT013457.1 Lycopersicon esculentum clone 132113R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015067595.10.0squamosa promoter-binding-like protein 6
RefseqXP_015067596.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A3Q7FQM40.0A0A3Q7FQM4_SOLLC; Uncharacterized protein
STRINGPGSC0003DMT4000630460.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-45SBP family protein