PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g030140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 530aa    MW: 59091.7 Da    PI: 7.071
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g030140.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3764.6e-1151575291374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn..sseelaalklfsevsPi 90 
                       lv+lL++cAeav+ +d+++a+ lL++l+  a   g+++qR+a++f+++La rla  +  +++  +++ + ++++   +++ +al+l++e++P 
  Sopen03g030140.1 157 LVQLLITCAEAVACRDKSRASVLLSELRASALVFGTSFQRVASCFMQGLADRLALvQPLGTVGYVATPAMNKTDiaLEKKEKALRLLYEICPH 249
                       689**************************************************98433345445555555444466899999*********** PP

              GRAS  91 lkfshltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                       ++f+h++aN  Ilea+ege+ +H++D+++s    +G QW  L q+L +Rp++pp +lRiT+vg+    + e+l+ +g+ L+++A++lg+++e 
  Sopen03g030140.1 250 IQFGHFVANCLILEAFEGESFIHVVDLGMSlglpHGHQWRRLVQSLVNRPGQPPrRLRITAVGQ----NIEKLQIIGDELEDYARSLGINLEL 338
                       **************************99874444678*************877779********....99*********************** PP

              GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                       ++ v+++le+l++++++v  gE+l+Vn++lqlh +++es    +   +vL++v +lsPk++v+veq+++hn++ Fl rf+eal+yysa+fdsl
  Sopen03g030140.1 339 SA-VESNLENLKPKDIKVYDGEVLVVNSILQLHCVVKESRGALN---SVLQVVHELSPKILVLVEQDSSHNGPFFLGRFMEALHYYSAIFDSL 427
                       **.79*******************************88877777...8********************************************* PP

              GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWk 363
                       ++ lp+ +  r+k+E++++++ei+n+v+ceg +r+erhe++ +Wr+r+++aGF+++p++  +++qak  l+kv+  +g+++ ee+g+lvlgWk
  Sopen03g030140.1 428 DVMLPKYDTRRAKIEQFYFAEEIKNIVSCEGPARVERHERVDQWRRRMSRAGFQAAPIK--MVSQAKQWLAKVNgHEGFTITEEKGCLVLGWK 518
                       *********************************************************96..79****************************** PP

              GRAS 364 drpLvsvSaWr 374
                       ++p+v++S+W+
  Sopen03g030140.1 519 SKPIVAASCWK 529
                       **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.416131510IPR005202Transcription factor GRAS
PfamPF035141.6E-112157529IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MIHDMANVFL SLEPCNGDQI GYDPMENGLY LTHHKELSYS LNPYTSVLKR NAPTNNMIIS  60
SLSNDSASFK RLRRTPSLGE SFGSNTTFYS TDSSSSGGSL PRIGSTNSVN SLSLQPGIHF  120
RDHVWALNQR YLAAEAIEEA AADIINQEEE NGEGMKLVQL LITCAEAVAC RDKSRASVLL  180
SELRASALVF GTSFQRVASC FMQGLADRLA LVQPLGTVGY VATPAMNKTD IALEKKEKAL  240
RLLYEICPHI QFGHFVANCL ILEAFEGESF IHVVDLGMSL GLPHGHQWRR LVQSLVNRPG  300
QPPRRLRITA VGQNIEKLQI IGDELEDYAR SLGINLELSA VESNLENLKP KDIKVYDGEV  360
LVVNSILQLH CVVKESRGAL NSVLQVVHEL SPKILVLVEQ DSSHNGPFFL GRFMEALHYY  420
SAIFDSLDVM LPKYDTRRAK IEQFYFAEEI KNIVSCEGPA RVERHERVDQ WRRRMSRAGF  480
QAAPIKMVSQ AKQWLAKVNG HEGFTITEEK GCLVLGWKSK PIVAASCWKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A5e-621455287378Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754420.0HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015068956.20.0DELLA protein RGL1-like
TrEMBLA0A3Q7GDS20.0A0A3Q7GDS2_SOLLC; Uncharacterized protein
STRINGSolyc03g110950.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA81672130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.17e-80GRAS family protein