PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g022150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRF
Protein Properties Length: 461aa    MW: 50687.2 Da    PI: 6.6947
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g022150.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.74.3e-23119161244
               WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                        epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e
  Sopen03g022150.1 119 LEPGRCKRTDGKKWRCSRDVAPHQKYCERHMHRGRPRSRKHVE 161
                       69***************************************98 PP

2QLQ514.4e-186094236
               QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                      +FT+aQ+ +L++Q+++yKy+++ + vPp+Ll+ i+
  Sopen03g022150.1 60 PFTWAQWKELERQAMIYKYMVSAMSVPPDLLLSIS 94
                      9******************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.4E-115995IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-126093IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.7976095IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.213118162IPR014977WRC domain
PfamPF088794.2E-19120161IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MMGHHQDLHC SDGGANKMLC STDEASLLPP PPSAAVVRSL QPFDVVTNSQ GGMATALGYP  60
FTWAQWKELE RQAMIYKYMV SAMSVPPDLL LSISSGASHT TSATGSVQGQ RYTTNIRDLE  120
PGRCKRTDGK KWRCSRDVAP HQKYCERHMH RGRPRSRKHV EVHAGVSNAS DNKKTRLQVE  180
SIPTTTASQI NNRSTKQPFR STFQQIQNPL SFHVDKIGGN GIISTDSSFN ELHRSSGWMM  240
EGELVAKAGS GHQWQHLMDS NAGYSAHGYR EEALNFLVSR DMERTEHTGE FNFMTNPEFV  300
KDTSRDLING WSNDNVYNNS NNENLEASLW PSLGDISSSS LTLSIAMAAG DVLDEDMGLD  360
SRFMNTNQHK FWENSFPFAS GGPLAEVLHP SSSFSLGDNP TSSYTSNGDS ISPAATTVSS  420
PSGVLQKTMF SHSDGSVCNS PILAAPSNNI TPETVQFQWL R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754420.0HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015068264.10.0growth-regulating factor 3-like isoform X1
TrEMBLK4BI190.0K4BI19_SOLLC; Uncharacterized protein
STRINGSolyc03g082430.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-34growth-regulating factor 7