PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g010660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 97aa    MW: 11319.8 Da    PI: 8.2639
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g010660.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.64.7e-121481057
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57
                      +++NRe+ArrsR RK++ + eL   v  L +eN+ L ++l++ +k  +
  Sopen03g010660.1  1 MISNRESARRSRMRKQKHLNELWAQVNCLRNENHLLLNKLNHVSKIHD 48
                      689*************************************99988655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147029.74E-15148No hitNo description
PfamPF001701.1E-9149IPR004827Basic-leucine zipper domain
SMARTSM003386.4E-6156IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-9168No hitNo description
SuperFamilySSF579595.25E-11145No hitNo description
PROSITE profilePS502178.588145IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MISNRESARR SRMRKQKHLN ELWAQVNCLR NENHLLLNKL NHVSKIHDQA LEENAQLKEE  60
TAGLRQIVTK MHLMNGPNYP LKEFQLDDDE PCSGSSQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1815RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-121HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069239.11e-66PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC23e-25BZP43_ARATH; Basic leucine zipper 43
TrEMBLK4BGF42e-63K4BGF4_SOLLC; Uncharacterized protein
STRINGSolyc03g046440.1.15e-63(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.12e-21basic leucine-zipper 42