PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g007660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 175aa    MW: 20323.1 Da    PI: 5.5321
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g007660.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.55.2e-0751110463
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                        k+ rr ++NR++A+r R RK ++++ L++++k+Le+       ++e+ k++ +kl+ e+
  Sopen03g007660.1  51 MKKLRRTISNRLSAQRTRMRKIEYTDGLKKEAKNLEETIAFVGRKIENEKENKKKLQLEN 110
                       6999********************************988877778887777777776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.880.101.9E-8481IPR008917Transcription factor, Skn-1-like, DNA-binding domain
SMARTSM003380.001848112IPR004827Basic-leucine zipper domain
PfamPF001707.2E-751110IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.09E-75297No hitNo description
PROSITE patternPS0003605570IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MNEKRNKSDE PNLSLSLKTP IEYESINNIP TLEEAVNLEL KNGQVDPNVN MKKLRRTISN  60
RLSAQRTRMR KIEYTDGLKK EAKNLEETIA FVGRKIENEK ENKKKLQLEN QILQVQLDSI  120
TNKSNLLAVQ NEELKAELKR LKEPTKAVED EEYMDMDQYL NVDNMNFSPS KNDGI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-87HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069614.17e-84PREDICTED: basic leucine zipper 34-like
TrEMBLM1DJC41e-100M1DJC4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000899851e-100(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA76151929
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07160.13e-07bZIP family protein