PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g006520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 143aa    MW: 16442.7 Da    PI: 6.3364
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g006520.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.31.4e-121441053
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53
                      +++NR++ArrsR RK++  + L+  v +++++N + + ++++++
  Sopen03g006520.1  1 MISNRVSARRSRMRKQQLSDDLTSQVNQFKEQNNQIATNINMMT 44
                      689*********************************99999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579596.88E-10147No hitNo description
CDDcd147024.17E-14147No hitNo description
PfamPF001703.4E-8143IPR004827Basic-leucine zipper domain
SMARTSM003389.6E-8156IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.7E-9244No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MISNRVSARR SRMRKQQLSD DLTSQVNQFK EQNNQIATNI NMMTHLFLNV EAENSILRAQ  60
LVELNQRLQS LNEIISCTNS NRSLEKCIST FGGCDMHPMT ICLQDTSNID INHHHELGDL  120
MNPWNLLNVM NQPIMASSDS FMY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1815RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754420.0HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343386.14e-86PREDICTED: bZIP transcription factor 53-like
TrEMBLM1C2804e-86M1C280_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000581871e-85(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53724123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.11e-34G-box binding factor 6