PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g002160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 309aa    MW: 35922.2 Da    PI: 9.0182
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g002160.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.59.3e-3162115255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtpeLH +Fv+a+++LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Sopen03g002160.1  62 PRLRWTPELHLSFVSAIDRLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 115
                       8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-2858116IPR009057Homeodomain-like
PROSITE profilePS5129411.97958118IPR017930Myb domain
SuperFamilySSF466893.76E-1461116IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-2262117IPR006447Myb domain, plants
PfamPF002491.8E-863114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MTSDSIDLNE EVGDQEGIEV IISDESHEKI IDENNNNNNN STSCGDYENN KRVRQYVRSK  60
LPRLRWTPEL HLSFVSAIDR LGGQERATPK LVLQMMNVRG LSIAHVKSHL QMYRSKKLGE  120
FGQVLGHAYR TNNQGRSYLY GKLSQRLFNP LQDFKMKNGA IVLARNFNDD DNHFQNSFAK  180
TPYETKEKFP RYLENHEICP VRQRHFHEEK RWPPCEFNQN KLNSQSLFHQ NGPKWSCTYN  240
SLGPKFKTPF RFEMKQDKMF IKEKDYLLPD LQLGLSTTNQ DNNNSKEKNS SDINTMLSLS  300
LPSYSSSAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1963117458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1963117458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1963117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1963117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1963117357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1963117357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1963117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1963117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1963117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1963117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1963117458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1963117458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-141HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015068459.10.0uncharacterized protein LOC107012991
TrEMBLK4BE380.0K4BE38_SOLLC; Uncharacterized protein
STRINGSolyc03g006150.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-36G2-like family protein