PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g037140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 439aa    MW: 49588.7 Da    PI: 5.6105
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g037140.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS307.72.6e-94564362373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalklfsevsPilkf 93 
                       ++lL++cA+a++s+d++laq++L+ l+++a pdgd++qRl+  f++AL  r a+   +++k l+++ +++++ ++ ++  l  f++++P+++f
  Sopen02g037140.1  56 EQLLVHCANAIESNDATLAQQILWVLNNIAPPDGDSNQRLTCGFLRALILRAAK--IGTCKLLTANLNHSMEtHKFSIIELASFVDLTPWHRF 146
                       79****************************************************..666666666655544436666666677********** PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl.. 181
                       ++ +aN  Ileaveg + +Hi+Df++++++Q p+L++a +sR egpp +++T+ g+ e        ++ee+g +L +fA++ +v +ef+v+  
  Sopen02g037140.1 147 GFTAANTSILEAVEGYSIIHIVDFSLTHCMQIPTLIDAVSSRVEGPPLVKLTVAGATEDLppmLDLSYEELGAKLVNFARSRNVMMEFRVIps 239
                       ********************************************************776698888999**********************977 PP

              GRAS 182 .....vakrledleleeLrvkp......gEalaVnlvlqlhrlldesvsles.erdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                                 +++ +e+Lrv++      gEal++n++++lh++++e+  +++  r  +Lk++++l P++vv+v+++ad +s++++ r+ +a++
  Sopen02g037140.1 240 sssdgF----SNV-IEQLRVQNlirpdnGEALVINCHMMLHYIPEETRVISNsFRAMFLKAIRNLDPTIVVLVDEDADFTSNNLVCRLRSAFN 327
                       643333....333.66666665555677*****************99988886899************************************* PP

              GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                       y +  +d++++ lpr s++r+++E+  + ++i+n++a+eg +r er e +++W +r+++a F++  +se+ ++++k +l +++  g+ ++ ++
  Sopen02g037140.1 328 YLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENLIAQEGIQRLERLEPKSQWVQRMRNANFRSSGFSEEGVTEVKNMLDEHA-AGWGLKRDE 418
                       **************************.********************************************************.999****** PP

              GRAS 356 gslvlgWkdrpLvsvSaW 373
                       + lvl+Wk++++v+++aW
  Sopen02g037140.1 419 EDLVLTWKGHNVVFATAW 436
                       ****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.17929418IPR005202Transcription factor GRAS
PfamPF035149.0E-9256436IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MMQFTESLPP QVSSFSSLMM NKDSSTNNNQ IQRARPWPGF HTSKNLGNIG DTNCMEQLLV  60
HCANAIESND ATLAQQILWV LNNIAPPDGD SNQRLTCGFL RALILRAAKI GTCKLLTANL  120
NHSMETHKFS IIELASFVDL TPWHRFGFTA ANTSILEAVE GYSIIHIVDF SLTHCMQIPT  180
LIDAVSSRVE GPPLVKLTVA GATEDLPPML DLSYEELGAK LVNFARSRNV MMEFRVIPSS  240
SSDGFSNVIE QLRVQNLIRP DNGEALVINC HMMLHYIPEE TRVISNSFRA MFLKAIRNLD  300
PTIVVLVDED ADFTSNNLVC RLRSAFNYLW IPYDTVDTFL PRGSKQRQWY EADICWKIEN  360
LIAQEGIQRL ERLEPKSQWV QRMRNANFRS SGFSEEGVTE VKNMLDEHAA GWGLKRDEED  420
LVLTWKGHNV VFATAWVPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-475643888474Protein SHORT-ROOT
5b3h_B7e-485643834420Protein SHORT-ROOT
5b3h_E7e-485643834420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015063662.10.0scarecrow-like protein 32
SwissprotQ9SN221e-178SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A3Q7FB540.0A0A3Q7FB54_SOLLC; Uncharacterized protein
STRINGSolyc02g092570.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87812429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-180GRAS family protein