PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g030030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 609aa    MW: 66503.8 Da    PI: 4.6695
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g030030.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS356.44.1e-1092416082373
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkf 93 
                        + L+ecA+  + ++ e++ + L rl+e +s++gdpm+R+ +yf+eAL +rl++ + +++ +++ +        +e + ++k+f++++P+ kf
  Sopen02g030030.1 241 LKSLVECARLAE-SEPENVVKSLIRLRESVSQQGDPMERVGFYFLEALYNRLSScQAERTPSIFVT------APEELTLSYKAFNDACPYSKF 326
                       578******655.57888888999******************************333333333332......35678999************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                       +hltaNqaIlea+e+++r+Hi+Df+i +G+QW+a+lqaLa+R++g+p s+Ri g+ s   g   + +l +tg+rL++fA+ l+++fef++ + 
  Sopen02g030030.1 327 AHLTANQAILEATEKATRIHIVDFGIVHGIQWAAFLQALATRSAGKPvSVRISGIPSVVLGnsPAASLLATGNRLRDFAKLLDLNFEFEP-IL 418
                       *******************************************88777*********877788999************************.79 PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                       + +++l+ +++r++p+E laVn++lql++llde+    +   + L+l ksl+P +v++ e e+++n+  Fl+rf +al+yys++f+sl+ +l 
  Sopen02g030030.1 419 TPVQELNGSSFRIDPDEILAVNFMLQLYNLLDETNVGVK---TALSLAKSLNPSIVTLGEYEVNLNDVGFLQRFKNALKYYSTVFESLDPSLT 508
                       9******************************88877777...9************************************************** PP

              GRAS 277 reseerikvErellgreivnvvac.egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrp 366
                       r+s er+ vEr +lgr+i  +v    g  rre +e +e+W+e +e aGFkpv+ls++a++qak ll +++ s  + + ++   ++ l Wkd+p
  Sopen02g030030.1 509 RDSAERVQVERLILGRRIAGAVGLdDGGTRRECMEDKEHWKELMEGAGFKPVTLSHYAMSQAKILLWNYNySSSFGLIDSAPGFLsLAWKDNP 601
                       **********************7516778*****************************************9999999888777766******* PP

              GRAS 367 LvsvSaW 373
                       L++vS+W
  Sopen02g030030.1 602 LLTVSSW 608
                       ******* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.316214587IPR005202Transcription factor GRAS
PfamPF035141.4E-106241608IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MAYMCTDSGN LMAIAQQVIK QKQQQEQLQQ QEQQQQQQQQ FLGVNPLCLS PWTSNHQTLT  60
NSPTLGYGLT GSGFADPFQV AGGTDGAEPG FQFPNLEHHS TGFRFADFGG GPGGEFDSDE  120
WMESLIGGGD STGSSNLQSG CEAWQTSSEF TTLYGDPFPS CPNRLSIGSA PPPPPSSDLN  180
GVIFSETQKN LSSLQPQTSP WVAPSSSPPP IVQPASKESK VVSVDVLPCS SPESFSSKPL  240
LKSLVECARL AESEPENVVK SLIRLRESVS QQGDPMERVG FYFLEALYNR LSSCQAERTP  300
SIFVTAPEEL TLSYKAFNDA CPYSKFAHLT ANQAILEATE KATRIHIVDF GIVHGIQWAA  360
FLQALATRSA GKPVSVRISG IPSVVLGNSP AASLLATGNR LRDFAKLLDL NFEFEPILTP  420
VQELNGSSFR IDPDEILAVN FMLQLYNLLD ETNVGVKTAL SLAKSLNPSI VTLGEYEVNL  480
NDVGFLQRFK NALKYYSTVF ESLDPSLTRD SAERVQVERL ILGRRIAGAV GLDDGGTRRE  540
CMEDKEHWKE LMEGAGFKPV TLSHYAMSQA KILLWNYNYS SSFGLIDSAP GFLSLAWKDN  600
PLLTVSSWH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1482376091375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development (By similarity). Involved in environmental abiotic stress resistance. May increase the expression of stress-responsive genes (PubMed:20616154). Binds DNA in vitro (By similarity). {ECO:0000250|UniProtKB:Q53K16, ECO:0000250|UniProtKB:Q9SCR0, ECO:0000269|PubMed:20616154}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought and high salt stresses, and down-regulated by gibberellic acid (GA) treatment, but not by plant hormone abscisic acid (ABA) application in leaves. Under the salt treatment, expression is induced quickly, and it peaks at 3 hours. Under the drought treatment, the expression is not induced immediately, but reaches its maximum at 3 hours. Under the GA treatment, the expression becomes weaker within 5 hours. {ECO:0000269|PubMed:20616154}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015066975.10.0SCARECROW-LIKE protein 7
SwissprotA0A024B7I00.0SCL7_POPEU; SCARECROW-LIKE protein 7
TrEMBLA0A3Q7F8N50.0A0A3Q7F8N5_SOLLC; Uncharacterized protein
STRINGSolyc02g085340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89052429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein