PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g029530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 144aa    MW: 16446.5 Da    PI: 5.7681
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g029530.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.88.5e-122280563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                      ++ +r+++NRe+ArrsR +K+  + eL   v +L+++  +  +++++ ++ + ++++e+
  Sopen02g029530.1 22 RKRKRMISNRESARRSRMKKQTHLNELMAQVNQLKEQKNQIVSNINMVSQVYLNVEAEN 80
                      6789*******************************************999998888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.5E-111270No hitNo description
SMARTSM003381.4E-151882IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.0132083IPR004827Basic-leucine zipper domain
PfamPF001707.3E-82268IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.99E-112273No hitNo description
CDDcd147022.13E-152371No hitNo description
PROSITE patternPS0003602540IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MASPSGNSSS GSEDLQQLMD QRKRKRMISN RESARRSRMK KQTHLNELMA QVNQLKEQKN  60
QIVSNINMVS QVYLNVEAEN SVLRAQMAEL SNRLQSLNEI INCINSANST IDETEINCED  120
DFLNPWNLLH VNQPIMASAD AFMY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015065208.11e-101PREDICTED: bZIP transcription factor 53-like
TrEMBLK4BB001e-100K4BB00_SOLLC; Uncharacterized protein
TrEMBLM0ZVK31e-100M0ZVK3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000090681e-100(Solanum tuberosum)
STRINGSolyc02g084860.1.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53724123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.13e-44G-box binding factor 6