PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g028310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 220aa    MW: 24499 Da    PI: 10.2455
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g028310.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.26.4e-17150202456
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                       ++r  r++kNRe+A rsR+RK+a++ eLe +v+ L +eN +Lkk+ ++l+  +
  Sopen02g028310.1 150 DRRNQRMIKNRESAARSRARKQAYMNELESEVAHLVEENARLKKQQQQLRVDA 202
                       68999****************************************99998655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-15147211IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.392149199IPR004827Basic-leucine zipper domain
CDDcd147079.56E-22151198No hitNo description
Gene3DG3DSA:1.20.5.1702.0E-15151200No hitNo description
PfamPF001702.5E-14151199IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.6E-12151199No hitNo description
PROSITE patternPS000360155169IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MWSSSSDNRG LSASSSSSSS SSHSPFSPRL KTMEEVWKDI NLSSLQDHTT NYSSRDHHHL  60
HDHNHQAANF GGTILQDFLA RPFANEPSPA AAAAATAASP VSATTMLNLN SVPELHFFDN  120
PLRKNSILHQ PNASGRKRVV PETEDNSTGD RRNQRMIKNR ESAARSRARK QAYMNELESE  180
VAHLVEENAR LKKQQQQLRV DAANQVPKKN SLYRTSTAPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1369190.0EF136919.1 Solanum lycopersicum self-pruning G-box protein (SPGB) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015065278.11e-162PREDICTED: protein FD
SwissprotQ84JK23e-42FD_ARATH; Protein FD
TrEMBLA1YTV01e-118A1YTV0_SOLLC; Self-pruning G-box protein
STRINGSolyc02g083520.2.11e-118(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35722239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.13e-35bZIP family protein