PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g023480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 283aa    MW: 32002.5 Da    PI: 6.2321
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g023480.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.77.2e-354096359
            zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                      +++lkcprCds ntkfCyynny+ sqPr++Ck+C+r+Wt+GG+lrnvPvGggr++++
  Sopen02g023480.1 40 SESLKCPRCDSINTKFCYYNNYNKSQPRHYCKGCKRHWTEGGTLRNVPVGGGRKNKR 96
                      6789***********************************************976665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-233996IPR003851Zinc finger, Dof-type
PfamPF027016.9E-314295IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.9724397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGLSTKLVSI DDDGLDNWTT TTHNTPPEPP SIRRQPPSKS ESLKCPRCDS INTKFCYYNN  60
YNKSQPRHYC KGCKRHWTEG GTLRNVPVGG GRKNKRVRPT DPVDYITGRK HVKLEVNDQR  120
CPLITTTSMT NSITSSILPS VTLIRGNSTI TSAIDEDIKN LPSSSLPYDI FSNISQDHGN  180
THFSLIPNSS TNTQLSSNVY YSYEHMGKFD STILEESTIT TIMPITSNND LHSHEPWKVP  240
ETSNNDLIID ENMSNNYWNW NEFETLSNAA DLNISWDDLE IKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347078.10.0PREDICTED: dof zinc finger protein DOF2.2-like
TrEMBLK4B9860.0K4B986_SOLLC; Uncharacterized protein
STRINGSolyc02g078620.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-28Dof family protein