PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g021600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 337aa    MW: 39386.4 Da    PI: 9.8029
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g021600.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.9e-3260113255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtp+LH++Fv+a+e+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Sopen02g021600.1  60 PRLRWTPDLHRSFVHAIERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 113
                       8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.25856116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2956114IPR009057Homeodomain-like
SuperFamilySSF466898.96E-1559114IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-2360115IPR006447Myb domain, plants
PfamPF002491.6E-861112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MEKASSSSIN LNEDNKGELE EEEEVIEVED SNEKEIEGNY NTSSDVEKKN VRQYVRSKLP  60
RLRWTPDLHR SFVHAIERLG GQERATPKLV LQMMNVRGLS IAHVKSHLQM YRSKKLDESG  120
QVLGRGNNRS MQGRSYFFRS HLCGQRYNPI QDFKMKNGAI VLARNFNYDN RALKPHSFSR  180
PSYQAKNIFS RYLPWSSDNQ GGLVNSKFQK GEDLLRVKSW QTPRQVVIEQ NGIMPIRSTQ  240
FLEQKKFIPN QWEEKTAKNS HFLLQQNLGQ PFSKWNCRNN ALDQNLVTPC RIEMKEDKNG  300
FEEKEWLPDL QLRLSRSSDD KNEKRMDQSD INTMLSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-1861115458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-1861115458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-1861115357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-1861115357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-1861115357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-1861115357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-1861115458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-1861115458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-1861115458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-1861115458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-1861115458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-1861115458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-172HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015064273.10.0uncharacterized protein LOC107009450
TrEMBLA0A3Q7F3400.0A0A3Q7F340_SOLLC; Uncharacterized protein
STRINGSolyc02g076670.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-37G2-like family protein