PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen02g015800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TCP
Protein Properties Length: 96aa    MW: 10044.6 Da    PI: 4.8571
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen02g015800.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP74.82.5e-231582481
               TCP 24 lsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssss 81
                      ++a+caa +F+L++eLG+ +d++tieWLl++a+pai+++tgt++ +a+++++ s++  
  Sopen02g015800.1  1 MPALCAAHVFQLTKELGHRTDGETIEWLLRNAEPAIIAATGTCTLPATQVTTTSENIP 58
                      9*****************************************9999977633333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.8E-18163IPR005333Transcription factor, TCP
PROSITE profilePS5136919.506139IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MPALCAAHVF QLTKELGHRT DGETIEWLLR NAEPAIIAAT GTCTLPATQV TTTSENIPLS  60
QSQPSVLAPL TRATPVSGFP AAPLIAEVVI VPAPYV
Functional Description ? help Back to Top
Source Description
UniProtCan specifically bind site II elements in the promoter region of PP438/PNM1. {ECO:0000269|PubMed:21297037}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-132HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015064776.25e-51transcription factor TCP11-like
SwissprotQ9C5187e-22TCP8_ARATH; Transcription factor TCP8
TrEMBLA0A3Q7HYI78e-47A0A3Q7HYI7_SOLLC; Uncharacterized protein
TrEMBLG3BGV98e-47G3BGV9_SOLLC; TCP transcription factor 19
STRINGSolyc09g008030.1.11e-47(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.13e-24TCP family protein
Publications ? help Back to Top
  1. Mazur MJ, et al.
    Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci.
    Front Plant Sci, 2017. 8: p. 2043
    [PMID:29250092]