PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g053620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 271aa    MW: 29589.8 Da    PI: 6.5893
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g053620.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.91.1e-0886133451
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                        k  +r   N+eA r++R++Kka+ + Le++v  L a N++L k+l+ 
  Sopen01g053620.1  86 NKGKKRPVGNKEAVRKYREKKKARAASLEDEVVRLRAINQQLLKRLQG 133
                       577788999***********************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.8E-1377151No hitNo description
SMARTSM003381.3E-783150IPR004827Basic-leucine zipper domain
PfamPF077165.3E-1285132IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.57785132IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-689132No hitNo description
CDDcd146866.50E-1189142No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MADGELDISN QEMLSSSNFG EFSSSMDSFF NEILKDAHAC THAHTCNPPG PDNSHTHTCY  60
HVHTKIVPTT DDDKNPSDDT AESAENKGKK RPVGNKEAVR KYREKKKARA ASLEDEVVRL  120
RAINQQLLKR LQGQAVLEAE VARLKCLLVD IRGRIEGEIG SFPYQKPMKS GNTYQHIVNP  180
NFPGAYVVNS CNLQCDDQVY CLHPGAEGKN SDGTVLNGQG FNNCEFETLQ CLGNQTSGLE  240
EVPGCVVGNS TPTDNTSGRS KRKGGARTTT S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015056926.10.0PREDICTED: uncharacterized protein LOC107003163
SwissprotQ8GTS21e-107BZP23_ARATH; Basic leucine zipper 23
TrEMBLK4B4200.0K4B420_SOLLC; Uncharacterized protein
STRINGSolyc01g111580.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29892452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.18e-91bZIP family protein