PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g052610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 582aa    MW: 63703.5 Da    PI: 7.3965
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g052610.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.64e-11421479563
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       kr++r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l  l+  +  l+s++
  Sopen01g052610.1 421 KRAKRILANRQSAARSKERKMRYIAELEHKVQTLQTEATTLSAQLTLLQRDATGLTSQN 479
                       9************************************************9999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-18417481IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.898419482IPR004827Basic-leucine zipper domain
PfamPF001702.1E-9421479IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.0E-11421478No hitNo description
SuperFamilySSF579595.42E-11421472No hitNo description
CDDcd147036.40E-24422471No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MAGDNDEGHS DMVQRLQSSF GTSSSSLPKQ LQPISMNQLD IPQLTTSQFR GQMRQFSPNF  60
GVENSKRVGI PPSHPQMPPI SPYSQIPVTR PGNQQMGMQN FTSAGPSHSR SLSQPAFFSL  120
DSLPPLSPSP YRESPSTSMS DPISADVSMG DQDGNSHSLL PPTPFSRCNS SRAGESLPPR  180
KAHRRSNSDI PFGFSGIMQS SPPLVPLRSP GALERSVPSR DNLGGKPVQL VKRESMWERG  240
NDNNNVEGMG ERKSEGEVVD DLFSAYMNLD NIDAFNSSGT DEKLGIENRE DLDSRASGTK  300
TNGGDSSDNE ATSSVNDSSS GSMQKREGVK RSAVGDIAPT TRHYRSVSMD SFMGKLNFID  360
DSPKLPPSPG PRPGQLSPTN SLDGNSNSFS LEFGNGEFSG AELKKIMANE KLAEIALADP  420
KRAKRILANR QSAARSKERK MRYIAELEHK VQTLQTEATT LSAQLTLLQR DATGLTSQNS  480
ELKFRLQAME QQAQLRDALN EALTAEVQRL KIATAELSAD ASKFQQLSLN PQMFQSQQQQ  540
SNQLNMHQLQ QQQQQQQSSQ PQQHAQARQQ LNSSTTSKHE SK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0145760.0BT014576.1 Lycopersicon esculentum clone 134031F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004230901.10.0PREDICTED: probable transcription factor PosF21
RefseqXP_015062011.10.0PREDICTED: probable transcription factor PosF21
TrEMBLK4B3R10.0K4B3R1_SOLLC; Uncharacterized protein
STRINGSolyc01g110480.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12652478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-138bZIP family protein