PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g047160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 274aa    MW: 29092.4 Da    PI: 6.0553
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g047160.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.21.7e-13218270456
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                        +++rr++kNRe+A rsR+RK+a++ eLe  v +Le+eN +L  e ee +ke 
  Sopen01g047160.1 218 QQKQRRMIKNRESAARSRERKQAYTVELESLVTQLEEENARLLREEEEKNKER 270
                       589**************************************998877766664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.6E-6215273IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.116217269IPR004827Basic-leucine zipper domain
PfamPF001704.5E-12218270IPR004827Basic-leucine zipper domain
CDDcd147073.84E-22219259No hitNo description
SuperFamilySSF579591.13E-9219269No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-12220272No hitNo description
PROSITE patternPS000360222237IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MASKVMPSAS TTPNSDRSLH PQNPSSSLNH SHPSRNFDSM NMDEILKNIY SDSDPFACSV  60
SATAAVHTPS ATAAGGGGGV GDVGPTKTVD EVWREIVAGG GGGSREPEMT LEDFLTKAGA  120
VTEEDVRVPV IAPPPPPPPP PATGAPSARG FVVDNMMGTG NCQFPVAMQN GPGGYGMEPQ  180
PHMGFGNGVV AITGSGSGSG RGKRRSTVEE LPADRATQQK QRRMIKNRES AARSRERKQA  240
YTVELESLVT QLEEENARLL REEEEKNKER LKQV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015064397.10.0PREDICTED: G-box-binding factor 4-like
TrEMBLK4B2391e-159K4B239_SOLLC; Uncharacterized protein
STRINGSolyc01g104650.2.11e-158(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.12e-20bZIP family protein