PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g046280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 379aa    MW: 43105.6 Da    PI: 8.7061
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g046280.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.46.5e-082452891761
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                       A+rsR RK+++i+eLe+ v++L+ae ++   ele l+++   l +
  Sopen01g046280.1 245 AQRSRVRKLQYIAELERNVQALQAEGSEVSAELEFLNQQNLILSM 289
                       89**********************************999876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.2E-4234293IPR004827Basic-leucine zipper domain
CDDcd147031.60E-15236284No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-5245288No hitNo description
SuperFamilySSF579596.19E-6245287No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MENSKGPCTM RNMMYNGKSS LLPPKSPFPS MAPSYIDYVP SSAFNQKGIQ KPREGNSHHQ  60
RTSSESCIIE EQPSWLDDLL NEPETPVRRG SHRRSSSDSF AYFDSVNAAN LDYTAQVDNK  120
FRNMPPIPSW GSQDFDYYKD ARQAASFVDQ NSSIRRKNRE KDVSSTTVSH LRSLSSPGED  180
LHIQRSGSPC LLQDGERPRS AGSDKQDVAE SGPPYPKGSA EKKDSSQSKS SSSETDTKRA  240
KQQFAQRSRV RKLQYIAELE RNVQALQAEG SEVSAELEFL NQQNLILSME NKALMQRLEN  300
LAQEQLIKYL EHEVLERERG RLRALYQQQH QQPQPQPQQQ KPSYSHRRST SRDLDQQFAN  360
LTLKQKEAER DAVSGQLHI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0133190.0BT013319.1 Lycopersicon esculentum clone 135006R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089133.10.0PREDICTED: uncharacterized protein At4g06598-like isoform X1
SwissprotQ8W3M71e-64Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLM1CBU50.0M1CBU5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000641690.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27651733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.24e-84bZIP family protein