PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g046250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 377aa    MW: 42769.3 Da    PI: 9.1823
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g046250.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.71e-072452821754
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                       A+rsR RK+++i+eLe+ v++L+ae ++   ele +++
  Sopen01g046250.1 245 AQRSRVRKLQYIAELERNVQALQAEGSEVSAELEFINQ 282
                       89***********************9999999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0016234293IPR004827Basic-leucine zipper domain
CDDcd147031.19E-14236284No hitNo description
Gene3DG3DSA:1.20.5.1702.7E-5245287No hitNo description
SuperFamilySSF579591.69E-5245287No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MANSKGPCTM RNMMYNGKSS LLPPKSPFPS MAPSYVDYVP SSAFNQKGIQ KPREGNSHHQ  60
RTSSESCIIE EQPSWLDDLL NEPETPVRRG SHRRSSSDSF AYFDSVNAAN LDYTAQVDNK  120
FRNMPPIPSW GSQDFDYYKD ARQAASFVDQ NSSIRRKNRE KDVSSTTVSH LRSLSSPGED  180
LRIQRSGSPC LLQEGERPRS AGSDKQDVAE SGPPYPKGSA EKKDSSQSKS SSSETDTKRA  240
KQQFAQRSRV RKLQYIAELE RNVQALQAEG SEVSAELEFI NQQNLILSME NKALKQRLEN  300
LAQEQLIKYL EHEVLERERG RLRALYQQQH QQPQPQQQKP SHSHRRSTSR DLDQQFANLT  360
LKQKEAELDA VSGQLHI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0133190.0BT013319.1 Lycopersicon esculentum clone 135006R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015089153.10.0PREDICTED: uncharacterized protein At4g06598-like
SwissprotQ8W3M74e-65Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLM1CBU50.0M1CBU5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000641690.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27651733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.24e-81bZIP family protein