PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g043980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 138aa    MW: 15432.6 Da    PI: 10.0737
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g043980.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.51.7e-142577557
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57
                      k+ +r+++NRe+ArrsR +K++ ++ L+ +v  L++ Nk   ++++e ++ +a
  Sopen01g043980.1 25 KKRKRMISNRESARRSRMKKQKLLQDLTGEVSRLQGANKNIVSKIDETTDRYA 77
                      899********************************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-162185IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-112373No hitNo description
PROSITE profilePS502179.7142371IPR004827Basic-leucine zipper domain
PfamPF001702.9E-122577IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.21E-112577No hitNo description
CDDcd147025.03E-152677No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MSPLRQSASS SASDDDQRYA GMDEKKRKRM ISNRESARRS RMKKQKLLQD LTGEVSRLQG  60
ANKNIVSKID ETTDRYAICA AQNNVLRAQA MELTDRLRYL NDVIDSTGLA ADVADPLLKP  120
LQNPCPMQPI ASSGLFKF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015070932.12e-97PREDICTED: bZIP transcription factor 53-like
SwissprotQ9LZP84e-39BZP53_ARATH; bZIP transcription factor 53
TrEMBLQ6A1K99e-96Q6A1K9_SOLLC; Anaerobic basic leucine zipper protein
STRINGSolyc01g100460.2.13e-95(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA111261525
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.13e-37basic region/leucine zipper motif 53