PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g043700.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 666aa    MW: 75699.6 Da    PI: 6.6767
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g043700.2genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS366.92.8e-1122866571374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+ lL++cA+a+++ d + a++lL r++e+++p+gd ++Rla+y+++AL+arl+++++ ly a +ps+ s    ++ l+a+k+f  ++P+  +
  Sopen01g043700.2 286 LRALLTQCAQAMANYDSRTANELLMRIREHSTPHGDGTERLAHYLANALEARLSGTGTALYTAYAPSRIS---AANILKAYKAFITACPFKLL 375
                       5789************************************************************999998...899***************** PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       s++ aN+ I + ++g+ ++HiiDf+i +G+QWp+L+q L+ R++gpp+lRiTg++ p++g   + ++eetg+rL+k++++++vpf f++ +ak
  Sopen01g043700.2 376 SNIFANKYIRKVIAGAPKIHIIDFGILYGFQWPCLIQGLSMRAGGPPELRITGIDLPQPGfkPAGRVEETGRRLEKYCKRFNVPFVFKA-IAK 467
                       ***********************************************************9999**************************.7** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e+++leeL+v+++E+l+Vn+ ++l +++de+v  +s+rd+vL+l+++++P+++++   +   n++ F++rf eal ++s+l+d++ea+lpr
  Sopen01g043700.2 468 KWESITLEELEVQRDEVLVVNSLYRLGNIPDETVIPNSPRDAVLNLIRRIRPDLFIHGALNGTFNTPFFVTRFREALFHFSSLYDMFEATLPR 560
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       e+e+r+  E+e+++r+++nv+aceg+er+er et+++W+ r  +aGFk+vpl+++++k ++  +r  + + ++v+e+ +++++gWk+r ++++
  Sopen01g043700.2 561 EDEDRKLFEEEVFARDAMNVIACEGTERVERPETYKQWQLRCVRAGFKQVPLDQEIVKIVRNKVRSEYHRDFSVDEDGHWMLQGWKGRVIYAL 653
                       ********************************************************************999********************** PP

              GRAS 371 SaWr 374
                       S+W+
  Sopen01g043700.2 654 SCWK 657
                       ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.988260637IPR005202Transcription factor GRAS
PfamPF035149.8E-110286657IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MEALFQEQLF PCADSFIFRH PSIPMDPRKE VIQNGVNNHP SFDQDYFSNH VVGVGDSSPP  60
PQEEGEKDYS DAMYKFLSQM LMEEDDLENK PCMFHDCMAL QAKERYLSDV LHGSENNYSP  120
QSVIINPHDS SSFLSNYSPD SIESPQWDLN FESPASMSTL SNHDSFFTSF GNGHFEEGAV  180
NVFQSGSSSN SPTGLREKKN RHRGDVAADQ QRSNKQMATF VHDESEPLEM YDNVLLCLNN  240
PYVEQHSATS VTSYSPPNEA KKASKVGRPR GGRKHSSIVK KEMVDLRALL TQCAQAMANY  300
DSRTANELLM RIREHSTPHG DGTERLAHYL ANALEARLSG TGTALYTAYA PSRISAANIL  360
KAYKAFITAC PFKLLSNIFA NKYIRKVIAG APKIHIIDFG ILYGFQWPCL IQGLSMRAGG  420
PPELRITGID LPQPGFKPAG RVEETGRRLE KYCKRFNVPF VFKAIAKKWE SITLEELEVQ  480
RDEVLVVNSL YRLGNIPDET VIPNSPRDAV LNLIRRIRPD LFIHGALNGT FNTPFFVTRF  540
REALFHFSSL YDMFEATLPR EDEDRKLFEE EVFARDAMNV IACEGTERVE RPETYKQWQL  600
RCVRAGFKQV PLDQEIVKIV RNKVRSEYHR DFSVDEDGHW MLQGWKGRVI YALSCWKPTK  660
QSVKLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B8e-4328865935421Protein SHORT-ROOT
5b3h_E8e-4328865935421Protein SHORT-ROOT
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015058083.10.0scarecrow-like protein 33 isoform X1
TrEMBLQ00LP50.0Q00LP5_SOLLC; GRAS4
STRINGSolyc01g100200.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein