PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g043700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 642aa    MW: 72893.4 Da    PI: 6.8246
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g043700.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3672.6e-1122626331374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+ lL++cA+a+++ d + a++lL r++e+++p+gd ++Rla+y+++AL+arl+++++ ly a +ps+ s    ++ l+a+k+f  ++P+  +
  Sopen01g043700.1 262 LRALLTQCAQAMANYDSRTANELLMRIREHSTPHGDGTERLAHYLANALEARLSGTGTALYTAYAPSRIS---AANILKAYKAFITACPFKLL 351
                       5789************************************************************999998...899***************** PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       s++ aN+ I + ++g+ ++HiiDf+i +G+QWp+L+q L+ R++gpp+lRiTg++ p++g   + ++eetg+rL+k++++++vpf f++ +ak
  Sopen01g043700.1 352 SNIFANKYIRKVIAGAPKIHIIDFGILYGFQWPCLIQGLSMRAGGPPELRITGIDLPQPGfkPAGRVEETGRRLEKYCKRFNVPFVFKA-IAK 443
                       ***********************************************************9999**************************.7** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e+++leeL+v+++E+l+Vn+ ++l +++de+v  +s+rd+vL+l+++++P+++++   +   n++ F++rf eal ++s+l+d++ea+lpr
  Sopen01g043700.1 444 KWESITLEELEVQRDEVLVVNSLYRLGNIPDETVIPNSPRDAVLNLIRRIRPDLFIHGALNGTFNTPFFVTRFREALFHFSSLYDMFEATLPR 536
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       e+e+r+  E+e+++r+++nv+aceg+er+er et+++W+ r  +aGFk+vpl+++++k ++  +r  + + ++v+e+ +++++gWk+r ++++
  Sopen01g043700.1 537 EDEDRKLFEEEVFARDAMNVIACEGTERVERPETYKQWQLRCVRAGFKQVPLDQEIVKIVRNKVRSEYHRDFSVDEDGHWMLQGWKGRVIYAL 629
                       ********************************************************************999********************** PP

              GRAS 371 SaWr 374
                       S+W+
  Sopen01g043700.1 630 SCWK 633
                       ***8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.988236613IPR005202Transcription factor GRAS
PfamPF035148.9E-110262633IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MDPRKEVIQN GVNNHPSFDQ DYFSNHVVGV GDSSPPPQEE GEKDYSDAMY KFLSQMLMEE  60
DDLENKPCMF HDCMALQAKE RYLSDVLHGS ENNYSPQSVI INPHDSSSFL SNYSPDSIES  120
PQWDLNFESP ASMSTLSNHD SFFTSFGNGH FEEGAVNVFQ SGSSSNSPTG LREKKNRHRG  180
DVAADQQRSN KQMATFVHDE SEPLEMYDNV LLCLNNPYVE QHSATSVTSY SPPNEAKKAS  240
KVGRPRGGRK HSSIVKKEMV DLRALLTQCA QAMANYDSRT ANELLMRIRE HSTPHGDGTE  300
RLAHYLANAL EARLSGTGTA LYTAYAPSRI SAANILKAYK AFITACPFKL LSNIFANKYI  360
RKVIAGAPKI HIIDFGILYG FQWPCLIQGL SMRAGGPPEL RITGIDLPQP GFKPAGRVEE  420
TGRRLEKYCK RFNVPFVFKA IAKKWESITL EELEVQRDEV LVVNSLYRLG NIPDETVIPN  480
SPRDAVLNLI RRIRPDLFIH GALNGTFNTP FFVTRFREAL FHFSSLYDMF EATLPREDED  540
RKLFEEEVFA RDAMNVIACE GTERVERPET YKQWQLRCVR AGFKQVPLDQ EIVKIVRNKV  600
RSEYHRDFSV DEDGHWMLQG WKGRVIYALS CWKPTKQSVK LV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_B6e-4326463535421Protein SHORT-ROOT
5b3h_E6e-4326463535421Protein SHORT-ROOT
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015058087.10.0scarecrow-like protein 11 isoform X2
TrEMBLQ00LP50.0Q00LP5_SOLLC; GRAS4
STRINGSolyc01g100200.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein