PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g041000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 455aa    MW: 48756 Da    PI: 6.9232
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g041000.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.35.3e-16250305358
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                       + kr rr+ +NRe+ArrsR+RK+a + eLe+ v +L  eN++L k+l  +++++ +
  Sopen01g041000.1 250 DTKRVRRMLSNRESARRSRRRKQAHLTELETQVSQLRVENSSLLKRLTDISQKYNE 305
                       679*****************************************999999998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.4E-12247303No hitNo description
SMARTSM003383.1E-19248312IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.679250305IPR004827Basic-leucine zipper domain
PfamPF001701.4E-13251304IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.2E-11252302No hitNo description
CDDcd147023.32E-6253304No hitNo description
PROSITE patternPS000360255270IPR004827Basic-leucine zipper domain
PfamPF124982.2E-49319444IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MDRVFSVDDD IGDHFWSTPP TAELGVHSPT SAAAAAAAIS YSKMMNRSSS EWAFQRFLQE  60
AAGAAGTTTS SPPQPPTMAS SSSSSHQNDV VEIKDENLST PNLNSGTALN SKPAATLFGS  120
APPQNIHVDA EEYQAFLKSR LDLACAAVAL TRAKNLKPQD ASSIAPDKGP ETASASQSVS  180
HITSKGSGQE VRKVQDKDSG GPVGIPSLPA VQKKPGVQVK STTSGSSREL SDDDEAEGEA  240
ETTQGTDPAD TKRVRRMLSN RESARRSRRR KQAHLTELET QVSQLRVENS SLLKRLTDIS  300
QKYNESAVDN RVLKADVETL RAKVKMAEET VKRVTGLNPL FQAMSEMSSM AMPSFSGSPS  360
DTSTDTAVPV QDDPQHHYYQ QPPNNHMPTH DPRIQNGMVD VPPIGTVQQN PAAAAVGGNK  420
MGRTASMQRV ASLEHLQKRI RGEVSSCGTQ GRGEQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264271RRSRRRKQ
2266271SRRRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015062354.10.0PREDICTED: light-inducible protein CPRF2
SwissprotQ990901e-150CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLK4B0C00.0K4B0C0_SOLLC; Uncharacterized protein
STRINGSolyc01g097330.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29342444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.23e-65bZIP family protein