PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g039790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 685aa    MW: 76578.5 Da    PI: 6.6382
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g039790.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.21.6e-23111211198
                       EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                       f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   +
  Sopen01g039790.1 111 FCKILTASDTSTHGGFSVLRKHANEClpqldmtQ--ATPTQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--R 199
                       99**************************999543..445568************************************************..5 PP

                       SSEE..EEEEE- CS
                B3  87 rsefelvvkvfr 98 
                       ++++el+v+v+r
  Sopen01g039790.1 200 DDSGELRVGVRR 211
                       68999*****98 PP

2Auxin_resp101.88.7e-34237316183
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                       a+ha++t++ F v+Y+Pr+  s+F+v ++k+++a+++ +svGmRf+m+fe+eds+err++Gt+vg+ d+++ +W++SkWrsLk
  Sopen01g039790.1 237 ASHAITTQTRFVVYYKPRT--SQFIVGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERRFTGTIVGTGDISS-QWSESKWRSLK 316
                       789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.15E-39103240IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-39105226IPR015300DNA-binding pseudobarrel domain
CDDcd100172.28E-19109211No hitNo description
PROSITE profilePS5086312.167111213IPR003340B3 DNA binding domain
PfamPF023622.2E-21111211IPR003340B3 DNA binding domain
SMARTSM010195.6E-21111213IPR003340B3 DNA binding domain
PfamPF065071.2E-31237316IPR010525Auxin response factor
PfamPF023095.4E-13559660IPR033389AUX/IAA domain
SuperFamilySSF542777.36E-14565646No hitNo description
PROSITE profilePS5174527.102570662IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MGTEDLYRDL WKACAGPLVD VPREGERVYY FPQGHIEQLE ASTNQAVNQQ VPQFNLSSKI  60
LCRVFHVQLL AETETDEVYA QITLHPEPEQ EEPSKPDPCP PDLPKRTVHS FCKILTASDT  120
STHGGFSVLR KHANECLPQL DMTQATPTQD LVAKDLHGYE WRFKHIFRGQ PRRHLLTTGW  180
STFVTSKRLV AGDAFVFLRD DSGELRVGVR RLARQQSPIP QSVISSQSMH LGVLATASHA  240
ITTQTRFVVY YKPRTSQFIV GLNKYLEAVS HGFSVGMRFR MRFEGEDSPE RRFTGTIVGT  300
GDISSQWSES KWRSLKIQWD EPASMVRPDR VSPWEIEPFV ASTCVDVAQP GIKSKRPRPL  360
DLPRSEIAVA SAASPFWCPG SGPTLEVSHL GGITEVQSRD NQLFWSSKQS SSLSNGMSNT  420
SCRTHLSGAW QHNMLANGSL NLLRDSIEDN KQLITRSALL DYGSPMSSRV SSGLLHDQVN  480
RGSKHVISSA CRLFGIDLRN NSNNTPSKAK EMLGPNITSN CADEAPVVHD ESEVDKDQNV  540
GHLNPSEEKK QFQLEALPKD TQKQGPTSSR TRTKVQMQGV CVGRAVDLTA LSGYDDLISE  600
LEKIFDIKGE LCPRNKWEVV YTDDEGDMML VGDDPWLEFC KMVRRIFIYS SEEVKKMTPR  660
CKLPILSLEG EGTMPSVDSE LKAEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-168333916355Auxin response factor 1
4ldw_A1e-168333916355Auxin response factor 1
4ldw_B1e-168333916355Auxin response factor 1
4ldx_A1e-168333916355Auxin response factor 1
4ldx_B1e-168333916355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1354358KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015061983.10.0auxin response factor 18-like isoform X1
RefseqXP_015061984.10.0auxin response factor 18-like isoform X2
RefseqXP_015061985.10.0auxin response factor 18-like isoform X3
RefseqXP_015061986.10.0auxin response factor 18-like isoform X3
RefseqXP_015061987.10.0auxin response factor 18-like isoform X3
RefseqXP_027772391.10.0auxin response factor 18-like isoform X3
RefseqXP_027772394.10.0auxin response factor 18-like isoform X3
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A3Q7F6520.0A0A3Q7F652_SOLLC; Auxin response factor
STRINGSolyc01g096070.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]