PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g031250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 144aa    MW: 16601.6 Da    PI: 6.5375
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g031250.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1377.2e-122381563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                      ++ +r+++NRe+ArrsR+RK++ +eeL     +L+++ +  ++++e+   +  +l++e+
  Sopen01g031250.1 23 RKRKRMESNRESARRSRKRKQQHLEELMSQLTQLQNQSTIWREKIESVGRNFHTLDAEN 81
                      67899****************************************99988888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-101976No hitNo description
SMARTSM003384.0E-171983IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.0472184IPR004827Basic-leucine zipper domain
PfamPF001705.0E-92379IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.69E-112377No hitNo description
CDDcd147026.85E-152475No hitNo description
PROSITE patternPS0003602641IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MASTQQPASS GSDGQRYATN DERKRKRMES NRESARRSRK RKQQHLEELM SQLTQLQNQS  60
TIWREKIESV GRNFHTLDAE NNVLRAQMAE LTERLDSLNS LTRFWADANG LAVDIPEIPD  120
TLLEPWQLPC PIQPITASAD MFQF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12441RKRMESNRESARRSRKRK
23541RRSRKRK
33542RRSRKRKQ
43742SRKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234339.11e-103bZIP DNA-binding protein
RefseqXP_015061256.11e-103PREDICTED: bZIP transcription factor 53-like
SwissprotQ9LZP82e-46BZP53_ARATH; bZIP transcription factor 53
TrEMBLQ9SPF71e-103Q9SPF7_SOLLC; BZIP DNA-binding protein
STRINGSolyc01g079480.2.11e-103(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28102351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.19e-48basic region/leucine zipper motif 53