PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g031170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 452aa    MW: 51545.8 Da    PI: 6.8839
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g031170.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS222.71.8e-681524482302
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn..sseelaalkl.fsevsPil 91 
                        + Ll++Ae v +++  +a+++L++ + las++g+p+qR+++yf++AL +r+ r++ +l+ ++ +++++ ++  ++++++a  + +++  P+ 
  Sopen01g031170.1 152 AQILLAAAEKVFDQHYDRARKFLSQCQLLASKTGNPVQRAVFYFAQALGERIDRETGKLMPKICTETDELNSicVASRFHASYVaLHQEVPFT 244
                       689***************************************************8888887776666665557755555554445******** PP

              GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                        + h+t  qaIle+v+ + +vH iDf i  G+QW++L+qa a+R+ ++  +++iT+++s   ++ke++ etg+ L++fA++l+ pf+f+++  
  Sopen01g031170.1 245 HIVHFTGIQAILESVAMKPKVHLIDFLIRTGVQWASLIQAAAERKdNPIEHMKITVIES---VNKERVIETGKSLESFANSLNFPFSFKIIFL 334
                       ********************************************955566*********...78**************************999 PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        + ++l+ +++++kp+E l+++ ++ l  +     s++++ ++ ++++++l+P ++vv+e ea++ns+ F++rf+++l yysalfd+le  + 
  Sopen01g031170.1 335 PDRNQLTEDHFDIKPDEGLVIHAAFFLRAMI----SIPNCLETAMRVLRRLQPSLMVVSEVEANLNSPLFVNRFIDTLFYYSALFDCLEDVMK 423
                       9*************************99998....77777777************************************************** PP

              GRAS 277 reseerikvErellgreivnvvaceg 302
                       r++++r+++E    g  i+ v+  +g
  Sopen01g031170.1 424 RDDQHRMTLEVS-YGAGIRGVIRRKG 448
                       **********88.7888888887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.03125452IPR005202Transcription factor GRAS
PfamPF035146.3E-66152448IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MQDSTDIQNF CNNYGFYQEY AVNQQLQEMN KQQEELNEHA AHSAGQLSRG KTKLNNLETG  60
SNVDEVPFLS LAPFELLRNN PSRRRRRDKV RDVNGGANMH QKLSATQIMR LAGERFIQFS  120
SNKFININNL LHPYGSAFSD LSPEDNQDVE LAQILLAAAE KVFDQHYDRA RKFLSQCQLL  180
ASKTGNPVQR AVFYFAQALG ERIDRETGKL MPKICTETDE LNSICVASRF HASYVALHQE  240
VPFTHIVHFT GIQAILESVA MKPKVHLIDF LIRTGVQWAS LIQAAAERKD NPIEHMKITV  300
IESVNKERVI ETGKSLESFA NSLNFPFSFK IIFLPDRNQL TEDHFDIKPD EGLVIHAAFF  360
LRAMISIPNC LETAMRVLRR LQPSLMVVSE VEANLNSPLF VNRFIDTLFY YSALFDCLED  420
VMKRDDQHRM TLEVSYGAGI RGVIRRKGSL EV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-3317443326284GRAS family transcription factor containing protein, expressed
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18388RRRRDK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015081144.10.0DELLA protein RGL2-like
TrEMBLM1DFW30.0M1DFW3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000884000.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139101114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-39RGA-like 2