PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g031160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 584aa    MW: 66089 Da    PI: 4.8974
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g031160.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS293.26.7e-902125821374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn........sseelaalklfs 85 
                       lv+lLl++Ae v++++++la++l++r    as +g+p+qRl  yf++AL++r+ rs+   y     + t+e++        s  + aa+ + +
  Sopen01g031160.1 212 LVHLLLAAAEEVNNQQFHLASKLISRCMWVASDSGNPVQRLSYYFAKALEERIDRSTG-RY-----TCTDEDHhlkyikimSLGTNAAFLTCH 298
                       68*****************************************************322.22.....222222301122333333334445589 PP

              GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfe 177
                       ++ P+ ++ +++  q+I e v +++++H iDf+i  G+QW+ L+qaLa++  ++   l+iT+vgs    +ke+ e+t + L++f ++lg+pf+
  Sopen01g031160.1 299 QLIPFSQVMQFAGVQTIFENVRSAKKIHLIDFNIRSGIQWIVLIQALAEKGdSPIELLKITAVGS---IEKENFEATSNTLHSFTKSLGLPFS 388
                       *************************************************98344559********...679********************** PP

              GRAS 178 fnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                       f+++ +++++d++ e+ ++k++E++aV +   l ++l+++ +l++    ++k+v+s+ Pk++vv e ea+hns+sFl+rf+e+l +ysa+fd+
  Sopen01g031160.1 389 FDIVFVSDMKDFKKESANIKTDETVAVYCNSILRTMLSRPDCLDN----LMKVVRSIGPKIIVVGEVEANHNSPSFLNRFIETLFFYSAFFDC 477
                       ************************************966666666....******************************************** PP

              GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgW 362
                       +e  + r s  r+++E +++g+ i+n+va+e ++r+ r+ +le Wr+ + ++G+ + +lse+a  qa+l+l++++ +    ++++ + l++gW
  Sopen01g031160.1 478 FEDCMDRRSPCRTTIEGVYFGEGIRNIVAAEAEDRFTRNVKLEVWRAFFARFGMVEEELSESAWYQAHLILKQFAqGSSCDLQKDGKGLIIGW 570
                       ***************************************************************************77779999********** PP

              GRAS 363 kdrpLvsvSaWr 374
                       k+ p+ s+S W+
  Sopen01g031160.1 571 KGTPIHSLSIWK 582
                       ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.546186561IPR005202Transcription factor GRAS
PfamPF035142.3E-87212582IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
MTNVSISNDI FSDFQDDQFH LEGYERSELV VNGIEEGCVD IDSLYSICGL NNEENTSDEQ  60
VRTNLLEDQQ QSLSDWMQNH FLTNTVMPLQ PVQIQSTIEA PTNDDFPPQV PEPANSSNEK  120
PKPFSLASLE LLSNYGRLSK KSSEENLCTN ALSCEARLGN SHKLPMKEIL RAAGERYIQY  180
STQRLDGLSM FIHPYGSALS GLCMEETRDV ELVHLLLAAA EEVNNQQFHL ASKLISRCMW  240
VASDSGNPVQ RLSYYFAKAL EERIDRSTGR YTCTDEDHHL KYIKIMSLGT NAAFLTCHQL  300
IPFSQVMQFA GVQTIFENVR SAKKIHLIDF NIRSGIQWIV LIQALAEKGD SPIELLKITA  360
VGSIEKENFE ATSNTLHSFT KSLGLPFSFD IVFVSDMKDF KKESANIKTD ETVAVYCNSI  420
LRTMLSRPDC LDNLMKVVRS IGPKIIVVGE VEANHNSPSF LNRFIETLFF YSAFFDCFED  480
CMDRRSPCRT TIEGVYFGEG IRNIVAAEAE DRFTRNVKLE VWRAFFARFG MVEEELSESA  540
WYQAHLILKQ FAQGSSCDLQ KDGKGLIIGW KGTPIHSLSI WKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4123058221375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015072304.10.0DELLA protein RGL1-like
TrEMBLA0A3Q7EHN30.0A0A3Q7EHN3_SOLLC; Uncharacterized protein
STRINGSolyc01g079370.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.17e-50RGA-like 2