PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g005060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 182aa    MW: 20612.8 Da    PI: 7.5153
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g005060.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.41.8e-14112165558
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                       kr+rr+++NR +A+rsR+RK+a+++eLe   ++   eN++Lk+ +ee k+e  k
  Sopen01g005060.1 112 KRQRRMIRNRASAQRSRARKQAYTAELEAQLEKVRDENERLKSIVEEKKEETTK 165
                       9**********************************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-9107172IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.381110162IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-14112165No hitNo description
SuperFamilySSF579598.13E-11112162No hitNo description
PfamPF001702.7E-12112165IPR004827Basic-leucine zipper domain
CDDcd147075.03E-15112158No hitNo description
PROSITE patternPS000360115130IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MDVSEEESVG CYKVQPPQVQ EGFSDNLPDS ASLNELFRHF YQPEGNEVGS NSTHEGFGLS  60
YGIDQIFEQA ADVIAPARGN AQNLNSDGSD AAGGGNRRRR AATIEQETLM EKRQRRMIRN  120
RASAQRSRAR KQAYTAELEA QLEKVRDENE RLKSIVEEKK EETTKAQWMA NKMKKLRRSV  180
SF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755131e-127HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
GenBankHG9754401e-127HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015088261.11e-133PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLK4ATE71e-111K4ATE7_SOLLC; Uncharacterized protein
STRINGSolyc01g009510.1.11e-110(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1843744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.19e-09bZIP family protein