PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g004470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 146aa    MW: 16720 Da    PI: 9.8082
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g004470.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.51e-1678135462
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       ++r rrk+kNRe+A rsR+RK+a+  eL +kv  Le+eN++Lkke +el+++ ++l se
  Sopen01g004470.1  78 DRRLRRKIKNRESAARSRARKQAYHNELVNKVSHLEEENMKLKKE-KELENMLSELSSE 135
                       6899***************************************76.8999999999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.5E-1375134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.7677122IPR004827Basic-leucine zipper domain
PfamPF001706.7E-1478134IPR004827Basic-leucine zipper domain
CDDcd147072.18E-1679125No hitNo description
SuperFamilySSF579591.25E-1179125No hitNo description
Gene3DG3DSA:1.20.5.1703.1E-1479133No hitNo description
PROSITE patternPS0003608297IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MNSQERELTL GETTLEDYLV KAGLFVADAS LGHTMSLDNP MAMQNFVPPI GLSPSPSLSD  60
TPVSDRKRGA MDIDKTIDRR LRRKIKNRES AARSRARKQA YHNELVNKVS HLEEENMKLK  120
KEKELENMLS ELSSEPRYQL RRTTSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-166HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016577992.12e-82PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_016577983.12e-82PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9C5Q26e-28AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBLK4AT941e-103K4AT94_SOLLC; Uncharacterized protein
STRINGSolyc01g008980.2.11e-102(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA125961619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G41070.33e-12bZIP family protein