PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen01g004400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 475aa    MW: 53528.2 Da    PI: 6.3507
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen01g004400.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS464.27.7e-142504721374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l++lLl+cA++v++g+le+a+ +L ++s lasp+gd+mqR+a+yf+e La r++rs++++ykal++++ +   +se + + k+f+e +P+lk+
  Sopen01g004400.1  50 LIHLLLTCANHVANGNLENANIALDQISYLASPNGDTMQRIASYFAESLADRILRSWNGIYKALNSTKLR--VVSEDILVKKMFFEYFPFLKV 140
                       689**************************************************************99998..69******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrl 186
                       + ++aNqaI ea+ege++vHi+D+++s++lQW aLlq L++Rpegpp+lRiTgv++    +k+ le++++ L++ Ae+l++pf+f+  v+++l
  Sopen01g004400.1 141 ASVIANQAIIEAMEGEKMVHIVDLNASEPLQWRALLQDLSARPEGPPHLRITGVHQ----QKQVLEQIAHVLTEEAEKLDIPFQFHQ-VVSKL 228
                       ********************************************************....9**************************.799** PP

              GRAS 187 edleleeLrvkpgEalaVnlvlqlhrll..........................................................desvsle 221
                       e+l++e+Lrvk+gEala+++v+qlh+ll                                                          ++s+s+ 
  Sopen01g004400.1 229 ENLDIEKLRVKTGEALAISSVMQLHTLLahddepqkksplgfkhlngvhlqrailnqntlgdllenemmtnnvfspgnesasssplSSSAST- 320
                       ********************************************************************************986654333333. PP

              GRAS 222 serdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlek 314
                        + d +L+++++lsPkv+vv+eq+++hn+++++er++e+l++y+alfd+le +l r+s er kvE++++g+ei+n+vaceg er+erhe+l k
  Sopen01g004400.1 321 -KMDGFLHALWGLSPKVMVVTEQDSNHNGTTLMERLSESLYFYAALFDCLEFTLQRTSLERLKVEKMMFGEEIKNIVACEGGERKERHEKLDK 412
                       .5699**************************************************************************************** PP

              GRAS 315 WrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                       W +rl+ aGF++vpls++a+ qa++ll+ ++ +gy++++e+gs+v++W+dr+L+svSaWr
  Sopen01g004400.1 413 WFQRLDGAGFTNVPLSYYAMLQARRLLQSYSCEGYKIKDENGSVVICWHDRALFSVSAWR 472
                       ***********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.88224452IPR005202Transcription factor GRAS
PfamPF035142.7E-13950472IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 475 aa     Download sequence    Send to blast
MLQDDGSSSV TSSSPLQNFP MMSISPSFVG GGSPYQWLKD LKSEDRGLYL IHLLLTCANH  60
VANGNLENAN IALDQISYLA SPNGDTMQRI ASYFAESLAD RILRSWNGIY KALNSTKLRV  120
VSEDILVKKM FFEYFPFLKV ASVIANQAII EAMEGEKMVH IVDLNASEPL QWRALLQDLS  180
ARPEGPPHLR ITGVHQQKQV LEQIAHVLTE EAEKLDIPFQ FHQVVSKLEN LDIEKLRVKT  240
GEALAISSVM QLHTLLAHDD EPQKKSPLGF KHLNGVHLQR AILNQNTLGD LLENEMMTNN  300
VFSPGNESAS SSPLSSSAST KMDGFLHALW GLSPKVMVVT EQDSNHNGTT LMERLSESLY  360
FYAALFDCLE FTLQRTSLER LKVEKMMFGE EIKNIVACEG GERKERHEKL DKWFQRLDGA  420
GFTNVPLSYY AMLQARRLLQ SYSCEGYKIK DENGSVVICW HDRALFSVSA WRCRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-40344742380Protein SCARECROW
5b3h_D3e-40344742380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069744.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A3Q7E9470.0A0A3Q7E947_SOLLC; Uncharacterized protein
STRINGSolyc01g008910.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]