PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_215690_ridj.t1
Common NameSOVF_215690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family NAC
Protein Properties Length: 388aa    MW: 43323.3 Da    PI: 7.3434
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_215690_ridj.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.62.9e-54231481127
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhPtdeelvv+yLk+kv++++l++  +i+e+d+yk++Pw+Lp+k+  +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+v
  Sp_215690_ridj.t1  23 LPPGFRFHPTDEELVVHYLKRKVQSTPLPV-AIIAEIDLYKFDPWELPAKAVFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPV 113
                        79****************************.88***************8777899************************************* PP

                NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyr 127
                        ls+++e+vg+kk Lvfy g+ p+g+kt+W+mheyr
  Sp_215690_ridj.t1 114 LSTGNEKVGVKKALVFYGGKPPRGVKTNWIMHEYR 148
                        **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-6419187IPR003441NAC domain
PROSITE profilePS5100560.66523187IPR003441NAC domain
PfamPF023652.3E-2824148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MDSTHSPAAG GSHHELQESH PQLPPGFRFH PTDEELVVHY LKRKVQSTPL PVAIIAEIDL  60
YKFDPWELPA KAVFGEQEWY FFSPRDRKYP NGARPNRAAT SGYWKATGTD KPVLSTGNEK  120
VGVKKALVFY GGKPPRGVKT NWIMHEYRWV DSTKPTNNKP PGYDHCNNKK GGSLRLDDWV  180
LCRIYKKSNT SRAMDHERED SMEDMMMMGT SLSSMSMSMS MSMSMSIPSS INNMGHDQPL  240
SKPTTNSLNY GSFLNTHVDQ QGLFEGMMGG GVHVHHQGMD PGTPTSMLPL KRSLPSLYWG  300
DNNDHDTSGG AICGAQSPSK RLSMLQMSID NTNNNNSSEE SGGRSDHHEN NNNNNNNITS  360
MSNLLNQLPT QTTPPPPLHQ QQQQQQQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-77111921170NO APICAL MERISTEM PROTEIN
1ut4_B6e-77111921170NO APICAL MERISTEM PROTEIN
1ut7_A6e-77111921170NO APICAL MERISTEM PROTEIN
1ut7_B6e-77111921170NO APICAL MERISTEM PROTEIN
4dul_A6e-77111921170NAC domain-containing protein 19
4dul_B6e-77111921170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family (Probable). Together with NAC018/NARS2, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000305}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By Jasmonic acid (JA). {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021864744.10.0NAC transcription factor 56
SwissprotQ9LD443e-98NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A0K9Q8A90.0A0A0K9Q8A9_SPIOL; Uncharacterized protein (Fragment)
STRINGXP_010675608.11e-145(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-94NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]